SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010953816.1.22495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010953816.1.22495
Domain Number 1 Region: 290-386
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 449-740
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.83e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 35-88
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000018
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 4 Region: 211-302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000816
Family V set domains (antibody variable domain-like) 0.062
Further Details:      
 
Domain Number 5 Region: 134-201
Classification Level Classification E-value
Superfamily EF-hand 0.000000000055
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010953816.1.22495
Sequence length 802
Comment PREDICTED: follistatin-related protein 5 [Camelus bactrianus]; AA=GCF_000767855.1; RF=representative genome; TAX=9837; STAX=9837; NAME=Camelus bactrianus; breed=Alxa; AL=Scaffold; RT=Major
Sequence
MIFCSLSSGFLIQDGPWGSCENKYCGLGRHCVLSRETGQAECACVDLCNRHYKPVCGSDG
EFYENHCAVHRAACLKKHKITIVHNEDCFFKGDNCKATEYSKMKSMLLDLQNRKYVTQDN
ENPNGDDVFRKKLLVDQMFKYFDADSNGLVDINELTQVIKQEELGKDLSDCILYDLLKYD
DFNSDKHLALEEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGALRPPIIWKRN
NIVLNNLDLEDINDFGDDGSLYITKVTTTHMGNYTCYADGYEHISQTHIFQVNVPPVIRV
YPESQAREPGVTASLRCHAEGIPNPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRY
EDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVI
QPIECEFQRHIKPSEKLLGFQDEVCPKAQGDEVQRCVWASAVNVKDKFIYVAQPTLDRVL
VVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGTMDKASPTLQVITLASGNTPHHT
IHTQPVGKHFDCVDDFYIPSPTLVVTHMRFGFILHKDEAALQKIDLETMSYIKTISLKDY
KCVPQSLAYTHLGGYYFVGCKPDSTGAVPPQLVVDGVTDSVIGFNSDVTGTPYISPDGHY
LVSINDLKGLVRVQYVTIRGEIQETFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTD
VLFVELASGKVKMIKSLKEPLKAEEWPWNRKNRRIQDSGLFGQYLMTPSKDSLFILDGRL
NKLNCEITEVEKGNTVIWVGDA
Download sequence
Identical sequences XP_010953816.1.22495 XP_014412195.1.101512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]