SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010955926.1.22495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010955926.1.22495
Domain Number 1 Region: 431-649
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000226
Family HEAT repeat 0.078
Further Details:      
 
Domain Number 2 Region: 5-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000623
Family APC10-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010955926.1.22495
Sequence length 929
Comment PREDICTED: centrosomal protein of 104 kDa [Camelus bactrianus]; AA=GCF_000767855.1; RF=representative genome; TAX=9837; STAX=9837; NAME=Camelus bactrianus; breed=Alxa; AL=Scaffold; RT=Major
Sequence
MPHKIGFVVVSSSGHEDGFSARELMVHAPTVSGWRSPRFCQFPQEIVLQMVERCRVRKLQ
LLAHQCLIPSKVEFYVGQSLPERLAPRPAERFRRLGYVSLCDNEKTGCKARELKSVYVDA
VGQFLKLVFHQNHVNKYNAYNQVALVAINIIGDPADVSDESDVASREKLIDHYLGHSTED
PALEGTCTVKSDYISPLDDLAFDMYQDPEVAQIIRKLDERKREAVRKERYDYAKQLKQAI
ADLQKVGERLGRFEVEKRCAVEKEDYDLAKEKKQQMERYRSRVYEQLRLHDLMDAELMRR
PLDLPLQPLLHSVSPHHQQLVPSLPPPGERGAGSHLADPFLQEKPSAPAPDASPQCPAVD
QPPPTADPPPKTQPESLPYDERPLPAIRQQPGVAAVELERSDRDGSEAPRAGAAGEPEPL
TEKVLREASSAVDVLGEALVAGAYSRLWSHREGALLALYEQLSETPVGTPREDLKNTLRA
SVFLIRRAIRDIVTPVFQASLKLLKMIITQYIPKHKLSKLETAHCVERTVPLLLARTGDT
SARLRSTASNFIQEMALCKEVRSLQIIPAYLVQPLKAGSSAHLAISQMALLARLLRDLGT
EGAGFTVDSVMKFSARALEHRVPEVREAAVRLILGLYAQHRAAVLEHLPPADSATRKNVL
YKTIFEGFAKIDGRPTDAEIRAQKRVATEEAEKRKEEEMTALQGQAAAHLHSLLLEKESE
AAKAQDPDTPGGKAAPPSAPEIPDSRCLDNLCIFCGERSESFTEEGLDLHYWKHCLMLTR
CDHCRQVVEICSLTEHLLMECDKKASFGKCHRCSEAVVKEELPRHIKAKDCNPAKPEKLA
NRCPLCHENFTPGEEAWKAHLMGPAGCTMNLRRTHVLHKAPVPPPGFSSGLSSSSSESHV
QLTVWPARPPQQGPARPVPWELSDRRVRC
Download sequence
Identical sequences XP_010955926.1.22495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]