SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010967369.1.22495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010967369.1.22495
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily EF-hand 5.14e-45
Family Calmodulin-like 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010967369.1.22495
Sequence length 161
Comment PREDICTED: troponin C, slow skeletal and cardiac muscles [Camelus bactrianus]; AA=GCF_000767855.1; RF=representative genome; TAX=9837; STAX=9837; NAME=Camelus bactrianus; breed=Alxa; AL=Scaffold; RT=Major
Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Download sequence
Identical sequences A0A212CA50 F6KVT2 F7C8Y6 P63315 P63317 W5P2G4
NP_001029523.1.59421 NP_001029523.1.76553 NP_001123715.1.46622 NP_001272501.1.57651 XP_001493320.1.31192 XP_004018449.1.66739 XP_004661336.1.11716 XP_005898156.1.15283 XP_005959932.1.78601 XP_006044101.1.26621 XP_006196450.1.17985 XP_007116641.1.24612 XP_007174801.1.59432 XP_007451921.1.90284 XP_008511329.1.77740 XP_008570796.1.73410 XP_010850036.1.44457 XP_010967369.1.22495 XP_010983584.1.51371 XP_011977296.1.54773 XP_014724265.1.49734 XP_020729956.1.74333 XP_020827236.1.61212 ENSECAP00000017881 ENSOARP00000004614 ENSECAP00000017881 ENSSSCP00000012193 ENSBTAP00000055780 ENSBTAP00000055780 9796.ENSECAP00000017881 9823.ENSSSCP00000012193 ENSPCAP00000011077 ENSSSCP00000012193 ENSPCAP00000011077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]