SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010983199.1.51371 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010983199.1.51371
Domain Number 1 Region: 32-457
Classification Level Classification E-value
Superfamily Sema domain 1.57e-77
Family Sema domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1315-1440,1606-1762
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-34
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 888-978
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000945
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.043
Further Details:      
 
Domain Number 4 Region: 797-888
Classification Level Classification E-value
Superfamily E set domains 0.000000000000128
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 5 Region: 976-1056
Classification Level Classification E-value
Superfamily E set domains 0.00000000000607
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Domain Number 6 Region: 460-511
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000733
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010983199.1.51371
Sequence length 1830
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-D1, partial [Camelus dromedarius]; AA=GCF_000767585.1; RF=representative genome; TAX=9838; STAX=9838; NAME=Camelus dromedarius; breed=Arabia; AL=Scaffold; RT=Major
Sequence
VALVFHVSGFWSPPRLLLLLRGAARAGALEIQRRFPSPTPTNNFALDGAVGTVYLAAVNR
LYQLSSANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPSQGLVV
VCGSIYQGFCQLRRRGNISAVAVHFPPAAPPAEPVTVFPSMLNVAANHPNASTVGLVLPP
PAGTGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFDLN
PSDDNILKIKQGAKEQHKLGFVRAFLHPPDPQPDAQSYAYLALNSEARAGDKESQAQSLL
ARICLPRGAGGDAARTACFVEPAPDVVAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAH
LQHPLSIVQPLKATPVFRAPGLSSVAVASVGSYTVVFLGTVSGRLLKINLNESMQVVSRR
VVTVAYGEPVHHVMQFDPADPGYLYLMTSFQMARVKVAACAVHTTCGDCVGAADAYCCWC
ALETRCTLQQDCANSSQPHFWTSASEGPGRCPTMTVLPAEIDVRQEYPGMILQISGSLPS
LSGMEMACDYGDIRTVARVPGPAFGHQIAYCNLLPRDQFPPFPPHQDHVTVEMSVRVNGQ
NIVRASFAIYDCSRVGQVYPHTACTSCLSAQWPCFWCTQQHACVSNQSRCEASPNPTSPQ
DCPQIVPSALAPMPTGSSQSLPVHLANAAFFQGAALECSFGHEELFEAVWVNESAVLCNQ
VVLHTTQKSQMFPLSLQLKGQPARFLDSPDPMTVEVYNCAMGSPDCSQCLGREDLGHLCV
WSDGCRLRGALPPLPGTCPAPEIRAIEPLSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIG
SVACEPLADRYTVSEEIVCATGPAPGAFSDVVTVNASKEGRSRERFSYVLPLVHSLEPAV
GPKAGGTRVTIHGNDLHVGSELQVLVNDTEPCTELVRTDTSITCTVPGGALPAPVPVCVR
FERRGCVRGNLTFWYMRNPVITAISPRRSPVSGGRTITVAGERFHMVQNVSMAVHHIGRE
PTLCKVLNSTLITCPSPGALNNASAPVIFFINGRAYADEVAVAEELLDPEEAQRGSRFRL
DYLPDPQFSTAKREKWIKHHPGEPLTLVIHKEQDSLGLESHEYRVKIGQVACDIQIVSER
VIHCSVNESLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVAL
FVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTEKSSQGIPFLEYKHFV
TRTFFPKCSSLYEERYVLPSQTLNSQGSSPVQETHPLLGEWKIPESCRPNMEEGISLFSS
LLNNKHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTGIMKELLVDLIDASA
AKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQVNKGSIDAITG
KARYTLSEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNV
PYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLT
DKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQ
KFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNI
LKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIV
QRYYKQIHDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMTALEAN
PTARRTQLQHKFEQVVALMEDNIYECCSEA
Download sequence
Identical sequences XP_010983199.1.51371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]