SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010983725.1.51371 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010983725.1.51371
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.48e-46
Family D-ribulose-5-phosphate 3-epimerase 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010983725.1.51371
Sequence length 160
Comment PREDICTED: ribulose-phosphate 3-epimerase isoform X5 [Camelus dromedarius]; AA=GCF_000767585.1; RF=representative genome; TAX=9838; STAX=9838; NAME=Camelus dromedarius; breed=Arabia; AL=Scaffold; RT=Major
Sequence
MHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYL
APWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTIHKCAE
AGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences ENSVPAP00000011777 XP_006779007.1.95426 XP_006779008.1.95426 XP_010958375.1.22495 XP_010958377.1.22495 XP_010958378.1.22495 XP_010983723.1.51371 XP_010983724.1.51371 XP_010983725.1.51371 XP_011367929.1.92234 XP_012388015.1.21590 XP_012401854.1.9362 XP_012401855.1.9362 XP_014317835.1.53796 XP_014317841.1.53796 XP_014401543.1.60319 XP_014401544.1.60319 XP_014412599.1.101512 XP_014412600.1.101512 XP_014412601.1.101512 XP_015095585.1.17985 XP_015095586.1.17985 XP_015451959.1.64745 XP_017511279.1.32401 XP_017511280.1.32401 XP_017511281.1.32401 XP_019512412.1.44202 XP_019512413.1.44202 XP_019512414.1.44202 XP_019512415.1.44202 XP_020931394.1.46622 ENSTTRP00000016536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]