SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011049426.1.86870 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011049426.1.86870
Domain Number 1 Region: 223-468
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.87e-51
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.000000977
Further Details:      
 
Domain Number 2 Region: 480-558
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000000214
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011049426.1.86870
Sequence length 735
Comment PREDICTED: ADAM 17-like protease isoform X1 [Acromyrmex echinatior]; AA=GCF_000204515.1; RF=representative genome; TAX=103372; STAX=103372; NAME=Acromyrmex echinatior; AL=Scaffold; RT=Major
Sequence
MEKRNVLFIYCTFLTLQSIYGLHRSLKYYETIHSTHFQHRILKRGIHHSYHPYNRISELE
FHSHGRHFRLILTPRREVIHSNFKAYEVNADGKEKTVHLDHDNFYHGRVFGEIESHAQMH
IDDGIMTGSITILDETFHIEPSWRHLSHLDNQTMIIYKSSDVKLSWEHYQDGEGHTHGTP
KTCGYVKEDINYTLNDNSEEDDTETDNSSSRVKRQTETYEYTPTKTRCPLLLVADYRFYQ
EMGASSTKTTINYLISLIDRVHKIYNDTLWQEHQEEDGFKGMGFVIKKIVVHSEPTRVRG
GETHYNMVREKWDVRTLLEVFSREYSHKDFCLAHLFTDLKFEGGILGLAYVGSPRRNSVG
GICTPEYFKNGYTLYLNSGLSSSRNHYGQRVITREADLVTAHEFGHNWGSEHDPDISECS
PSASQGGSYLMYTYSVSGYDVNNKRFSPCSLRSIRKVLQAKSGRCFSEPEESFCGNLRVE
GDEECDAGLLGTEDNDSCCDKNCKLRSNQGAVCSDKNSPCCQGCAYMPAGVKCRDAQYAT
CEQESRCTGASSECPRSPPMKDGTDCLERGQCRLGKCVPYCETQNLQSCMCDTIADACKR
CCRMNLNETCFPIDQQDILPDGTPCIQGFCNKGVCEKTIQDVVERFWDIIEDININKVMR
FLKDNIVGAVIIITAVIWIPASCVISYIDHRRVKESEKKWQWKHTDELIHPDEPRQVIYV
GGQRQQRVQHVMHQS
Download sequence
Identical sequences F4WB07
XP_011049426.1.86870 Aech_08529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]