SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011055086.1.86870 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011055086.1.86870
Domain Number 1 Region: 425-514
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000000144
Family Mannose 6-phosphate receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 234-295
Classification Level Classification E-value
Superfamily EF-hand 0.000000774
Family Calmodulin-like 0.039
Further Details:      
 
Domain Number 3 Region: 84-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  XP_011055086.1.86870
Domain Number - Region: 51-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000294
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011055086.1.86870
Sequence length 528
Comment PREDICTED: glucosidase 2 subunit beta [Acromyrmex echinatior]; AA=GCF_000204515.1; RF=representative genome; TAX=103372; STAX=103372; NAME=Acromyrmex echinatior; AL=Scaffold; RT=Major
Sequence
MDGHRASRFLALAASMSLLLATYTPGHVAGSGVLQIRGIPVAKNSLYRPDRDFECLDGSR
LISFTQVNDDYCDCGDGSDEPGTAACANGVFYCDNAGHKPAYIPSSWVNDGVCDCCDTSD
EYASRVECINNCNELSREARLVQQKVEQLAREGNKLRVELVARGKTIKTEHQSRLAKLRT
DYTEAELIKKEKELLKKQAEELESIALEKYKPAETEQPATEEAVGEEEEEDEDLNVSEVE
DYFKILDSDSSGTVTLVELQTRATFDKNRDGAVSEEEALYFLGDNKEVTLQEFTDNAWAN
IKPFLMLEQGIFKAAKERGEINEHQPTDDLDHEKEGEILDGEEEEVPEEEHEKESPEPEI
QYDEETQALIDEATNARERFQEAEKAINELQLEIGQLEDKLGRDYGPEEVFASLDGECFE
YTDLEYIYKLCFYAMATQKSKSGGSINLGHWNEWIGPTSAKYTKMKYDRGLTCWNGPARS
TIITLSCGMENKLMSVMEPNRCEYAMEFSTPALCNPNAAETVDKHDEL
Download sequence
Identical sequences F4WL80
XP_011055086.1.86870 Aech_02705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]