SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011056959.1.86870 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011056959.1.86870
Domain Number 1 Region: 96-548
Classification Level Classification E-value
Superfamily Sema domain 3.53e-123
Family Sema domain 0.0000632
Further Details:      
 
Domain Number 2 Region: 1435-1559,1814-1998
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 899-989
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000196
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 1078-1149
Classification Level Classification E-value
Superfamily E set domains 0.00000000000063
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 5 Region: 550-602
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000327
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 992-1078
Classification Level Classification E-value
Superfamily E set domains 0.00000000125
Family Other IPT/TIG domains 0.054
Further Details:      
 
Weak hits

Sequence:  XP_011056959.1.86870
Domain Number - Region: 862-895
Classification Level Classification E-value
Superfamily Plexin repeat 0.000227
Family Plexin repeat 0.0043
Further Details:      
 
Domain Number - Region: 1222-1285
Classification Level Classification E-value
Superfamily E set domains 0.000373
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 
Domain Number - Region: 699-735
Classification Level Classification E-value
Superfamily Plexin repeat 0.00406
Family Plexin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011056959.1.86870
Sequence length 2034
Comment PREDICTED: plexin-B [Acromyrmex echinatior]; AA=GCF_000204515.1; RF=representative genome; TAX=103372; STAX=103372; NAME=Acromyrmex echinatior; AL=Scaffold; RT=Major
Sequence
MRFLGFTQSFPKSPTVTHLQVPLPPLLHRLSFSSMSIVTWFLVILATAAIDTPASTVPPI
QDNKSPHIIAQFPAGNGQQYGHFSLDANATREGALRFNHLAIDPSSGRLYGAAINRLFQL
DSNLRLEEYVSTGPRLDNPQCHATGCMARDIPTSLMDNVNKLLIADVKSQMLIACGSLLQ
GACEKYQMSNISIKPEFIPHSVAANDENSSTYAFIGPEKYNPWEQTNILYVGTTFTNKGD
YRHDVPAISSRNLDNLEFAEYTFNKQSIVYIDVKYRDHFLVKYVYGFNASDYAYFVLVQK
QSYLPEQEELGYISRLARSCISDPNYDSYTEVTLQCTVDLGDGKQHHYNLVQDAKVAAAG
SDLAMQLGISVGDPVFVSVFSPSRGITNEPLSRSAVCIYSLQDIETKFNENIHMCFNGSI
KYRNMGYVSGPIQDGKCPTAGTTGNILNFCEVGLKISGVSPITGQAILHFPDTFISSVTI
ANTESHTVAFFGTNDGVLKKVLLSGVEAFVYESVTIDKGQKLLPDTLISPDGEYIYVLSN
SKISKVKVEHCNGYTNCSSCLDAKDPYCGWCSLEKRCTVRGDCQKASHSSPRWLSLGTGQ
QCIDFEQVLPDRMPINQMTTVQLTIRTLPELPTGANYKCVFGNAEPIDALMTGFGLSCPT
PPVVERPSIPEGADHVLVPLSVRSSETNKDFVSRNFAFFDCSRHTVCTECVKSQWACSWC
VYDNKCTHNTSCQGIISGENQNQANLAAHGAQYCPRFMERKEPLMLPNSVPKEIVLEVEN
LPHPQVGHSGFQCIVSIEGANLKVQARVDSSRFIVCDKTVYSYEEVSGEYEAEVTVVWNT
NHHVDKTTIILYKCEVLGSHREHADCSLCVTRDARFECTWCGNSCVYRHSCLQSPFTECP
KPRIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCTLVDYEVSVRIVCRT
GRHEATDAASVVVGNDAGYTESAVLFNYKDIRLSGVYPSVGPQSGGTQLAITGKYLNIGS
TISAYLDELPCHVNATQASSTRLTCVTSKSGRVRRIHRLTLSIDGANRTLMDNPYNYTHD
PTIMEIKPLRSFASGGRMITVHGTNLDTIQKPEMEVYFDNEQLPVNRTVCTVLNPTQMEC
PSPSVAKRFVSIRRSERSATTSTLGTSSPHSLRLKESQLSLKIAFIMDNVESVRDLEKQS
LRNRLLYVEDPTFFPFPRNVKLYKGDTLVIEGENLNYASDESDVNVTVGIMPCNVTSLAL
TQLVCTPPDQQPADTDELGIKTESGLPLVVVRVGRSLRFPIGYLRYEVIKSYPIPPEAIA
GIAAGTFGLIFLFVLVLVIYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTDM
TDLTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRSNISRTNYDAAMIQFEQLV
NNKYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKAVNT
KHPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITHD
ARYSLSEERLLREQIEHTIVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTPF
SLRPSVHDVDLEWRHGRGGHLTLQDEDLTTKCCGEWKKINTLAHYGVKESAVMSLIPRQN
DGFSVACKPPCHNCKPSHYHPQQQPSIHPHHQPSHHHLHRHSNHCSSTHLPSTPNHGLIT
PVMYNHPVSGLYFDSQHSPPIITANGDVESAHGGNQRLYHLVRPIEDVHYPPGLGFTGSS
KHHHPERTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSAVKWLFDLLDEAA
KQHGIVDPEVAHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDSCSM
TEHRLGKDSPSNKLLFAKDIPHYREKVGRFYTDVQRLPQITDQEMSSAMQQLSASHANEF
DVIAALKELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVAYTLEGEETSAC
Download sequence
Identical sequences F4WPF1
XP_011056958.1.86870 XP_011056959.1.86870 Aech_01574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]