SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011065542.1.86870 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011065542.1.86870
Domain Number 1 Region: 46-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000124
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011065542.1.86870
Sequence length 201
Comment PREDICTED: prohormone-4 [Acromyrmex echinatior]; AA=GCF_000204515.1; RF=representative genome; TAX=103372; STAX=103372; NAME=Acromyrmex echinatior; AL=Scaffold; RT=Major
Sequence
MVRRFCNGAVALGIALTACAAFPRAVMAIDLSRFYGHFNTKRSEACHPYEPFKCPGDGIC
ISIQYLCDGAPDCQDGYDEDSRLCTAAKRPPVEETASFLQSLLASHGPNYLEKLFGTKAR
DTLKPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSIGIK
DSELGDVKFFLEKLVKTGFLD
Download sequence
Identical sequences A0A151HYJ9 A0A151II70 A0A151WX48 F4X4R8
PB21926-RA XP_011065542.1.86870 XP_011640966.1.19355 XP_018056628.1.4000 XP_018307538.1.62676 XP_018355067.1.14990 XP_018366392.1.32933 XP_018395987.1.22276 Aech_08551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]