SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011130539.1.81794 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011130539.1.81794
Domain Number 1 Region: 389-443
Classification Level Classification E-value
Superfamily RING/U-box 6.13e-19
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 2 Region: 209-274
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0000000232
Family Cdc48 domain 2-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011130539.1.81794
Sequence length 449
Comment ring finger protein [Gregarina niphandrodes]; AA=GCF_000223845.1; RF=representative genome; TAX=110365; STAX=110365; NAME=Gregarina niphandrodes; AL=Scaffold; RT=Major
Sequence
MPHPTEDNNIGDSDAATLSDFERQLTGHSCGVCVSTQNRIFRAYVAVKSNTLHKPREETI
RDYRLGPRIEGKIREIAIALLPGEEGDSSEAGKSPSESPAWKTAPASWVKSIKEVLTFGK
SLADSKGADEIRGRSQSEEQEEMLVALANALKERFAKRKCVLIYGGMHVKVAGQRLLITS
AIGEDQELAFCGLGTGDTVVTPALDDPGEFSKIHVCPFMDTIPQAYEMDIFQDALSPFFA
KHPLVLLAEGDTFQYNSVEFKVVSSKPASVPVRISLEKALSLPIEELIQSIPVNKRKHRV
GPSTAVCLGFPILPHWIDILSPARQHIVMSLPAPIQSLMLINFVSETGPSEIERVMNATE
AMGRPQLTPAARVKEMADSVSKLRVDVSKTMEEDGVCIICLGNLEKNDEIVKLSCSHVFH
SKCLLHWLVRTKTCPLCKVELTDIDLPKT
Download sequence
Identical sequences A0A023B6P0
XP_011130539.1.81794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]