SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011141652.1.56509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011141652.1.56509
Domain Number 1 Region: 557-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.34e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 145-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000764
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 300-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000391
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 474-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000126
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 606-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000169
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 528-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000208
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 415-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000815
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011141652.1.56509
Sequence length 1152
Comment PREDICTED: zinc finger protein 594 [Harpegnathos saltator]; AA=GCF_000147195.1; RF=representative genome; TAX=610380; STAX=610380; NAME=Harpegnathos saltator; strain=R22 G/1; AL=Scaffold; RT=Major
Sequence
MEVGGDLTLQWVEEVGNVELHEEVICDLEAQLVATEEEVIGACEEVAVEETVESVPDVAP
TTESEILMVSQPNDMESIYIVPQDQGHDYLNIQVTEEVIADNWDRQGPDDGVEIPEAKVA
HDNLLEYDDMEIPLPINQDSNTNIRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHSCNLC
GARYVRKCDLNNHLKIHAYAPSSRDGLEDEINDEDILAPEEEDMTTTVKGRRKKVQSNMP
RKRRGNNATGLPKRQSTQDASGVKMEMGNGNYASSSKWHEEMAVTNEQQSSRWPITDTTK
PYICQFCGVGFAREKALASHARIHGGDSPFECTSCSEMFWDVNSLREHVRVKHGDTMLQS
DTEEYDNDTAYASEERFGEFYCNICAVPFHRLDLLKRHQKIHIKQETDTMEGSSQHHVCN
VCGEWFEEALALLAHAELHARSPSRRCLLCGARCRDDADVAEHVRQNHAEDAPPNTCTLC
GKTCKDKRSLLKHSWVHNVDKTFGCTKCGKRFHSKARLRRHMVSHRNKMVACDECGEEFP
DGRALVSHRHSHNKDLGGRSFPCRECGKTFGSRSSQQIHIRIHTGERPYGCRFCWKAFAD
GGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPDPKYVGSATPFLCKVCG
EAYGTSEEIVAHIVQHCDDNTALRRQPQTGPRKYKRRRKLKPHETNTILRRNEFYDMIEG
GDGSGGGGGGDGISGGSGDVGVGVGVSIGIGDSIGDHGGDNGGSGSGGNGGIGDSDSEEN
IKRKLSRKNKQHKSNVEEGYQNVLKSFESSLQNINSIVNNSKLNTSKSKLSKKKLRKEEK
RSETQASNQSGRPKMIHTQKTRVPVEVGSDGVKKGQKTKTMVTRTPKVMPNEHKPGIFSG
GERNRPRTKNVSYHIEGKQQLSPATFLKMKEDTDPMSMQQQSQQQLLLTNIKVESDAQKA
ASTGGSHRNNNGNMLGLLKSESLAKKKSSTLKKTKRQKHIVKQERSDTSESGTEEQQEQQ
HQEYQLQLRNNNNVTENNGDSVRLMDHTMDGSNLEVAFEASVVTAEDQEDEDDDEEESIL
PDTGEEIGNGDVKLSVKVESAPQRMLAVHSVITPVDDVPETIIPDAVEYTCEMCAAVFSS
RAELLVHVPIHI
Download sequence
Identical sequences XP_011141652.1.56509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]