SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011214957.2.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011214957.2.58354
Domain Number 1 Region: 47-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 255-375
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000301
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 168-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 214-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 454-489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 415-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011214957.2.58354
Sequence length 767
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 3 [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MAVRASACVPKSRIHLLHAADDFEAIGLVNIVLTGRLSSAVPALAACSGKLEQHTERRGV
IYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEA
FRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNG
KCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPTERRCDG
TQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLL
QLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGH
GFNATYQVKGXXQPCGSGGEGAAGDAGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCXTWRCDGQEDCQD
GSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEA
EFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRR
RLGRLXXRLFHRPRVPRGQIPLLTAARTSQTVLGDGLLQPASGSTPDPPAPLTDTGSPVA
AGDGPPSAPGHGPEVGSAVLPPSGLRDPECRLVDKDRKAGRDPLVDSPAPVDMPREPCTA
QDPHPPAPTASSTLGPHPPEPLGVCRSPPPPCSPTLEASDDEALLVC
Download sequence
Identical sequences XP_011214957.2.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]