SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011225356.2.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011225356.2.58354
Domain Number 1 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 10-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 160-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 607-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 649-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000274
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 109-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000364
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011225356.2.58354
Sequence length 712
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 30, partial [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
NFTRHNVGLQFQGSVTFRDVAVPFSRXEWESLSPAQRHLYRDVMLENYSNLVSLAGYSFS
KPHVVTFLEQWKEPWMTVRKDQRRQYTDFQLKDETVSTKEMPTIEKCTSFALHQRILNRE
QSCECQKYGKTFCQGSNPVQHERTHSNEKPCKCKECGKNFSNGHKLTVRQRFHMGEKPYK
CKECGKAFTTFSYLVQHQRIHTVEKLYECEECGKAFIRGSAFVKHGRIHTGEKPYECKEC
GKNFGSSHQFTIRQSIHTGKKPYECGECGKAFYSSSYLVQHXRIHKDKKPYECKECGKAF
IVYGKLPWHQNIHTGEKPFVCKECGKAFSTFSYLVQHQRIHTGEKPYKCKECGKAFSSSS
PLVKHQRIHTGEKPYECRECGKTFTVYGQLTRHQSIHTGEKPFECKECGKTFRLSSFLNA
HQRIHAGVKPYKCKECGKAFSRVSYLVQHKRLHTGEKPYECKECGKAFSTGSYLVQHQRI
HTGEKPYECKECGKAFISSHQLTVHQRVHTGEKPYECKECGKAFRVHVHLTQHQKIHIDM
KPYKCKECGKTFSRASYLVQPGRVHTGEKPYECKECGKAFSSVSYLVQHQRIHTGEKPYE
CKECGKAFTVYGQLIGHQSVHTGEKPFECKECGKTFRLNSFLSEHQSIHSGKKPFKCKKC
GKAFRYSSALKVHQRNHMCVKPXEFKEFGKSIMYGSNIVQHQRIYANEKHGC
Download sequence
Identical sequences XP_011225356.2.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]