SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011227004.1.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011227004.1.58354
Domain Number 1 Region: 232-487
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.86e-63
Family Eukaryotic proteases 0.000000189
Further Details:      
 
Domain Number 2 Region: 51-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-23
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 193-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000344
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011227004.1.58354
Sequence length 491
Comment PREDICTED: complement C1r subcomponent-like protein [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MSSSRCLVSEWGNDHWRSPHSTSCPGKMWWLLLWGVLQACPTQGSVLLAKELPQQLTSPG
YPEPYLKGQESSTDIEAPEGFAVRLVFQHFDLEPSQDCEQDSVTITASGMDPSRFCGQQG
SPLGSPPGQREFVSPGNRLRLTFRAPASSQDGTTGLHKGFLALYQAVGVTHRRPIGQARG
ASEATSVPGDHPSKIQNPCQEPYYQAAPTGTLTCTPQGPWKGPQDGEELPRCVPVCGRPV
TAIDQNQEALGSSRAKLGNFPWQAFTNIYGRGGGALLGDRWVLTAAHTIYPKDGIFLGRN
RSVDVFLGHTSIDEMLRLGSHPVRRVVVHPDYRQHESHNFDGDIALLELQSAVPLGPSLL
PVCLPERQALYRSGVWGYVSGFGVDRGWLTTELKYSRLPVAPRAACRAWLLEKQRSEVFS
ANMFCAGDKMRQQSVCQGDSGGVYVVWDERAHHWVATGIVSWGVGCGKGYGFYTKVLNYR
DWIRGVMDGKD
Download sequence
Identical sequences G1M4L3
ENSAMEP00000014280 XP_011227004.1.58354 ENSAMEP00000014280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]