SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011232917.1.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011232917.1.58354
Domain Number 1 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 606-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 549-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.95e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 17-76
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 8 Region: 651-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 273-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000557
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 10 Region: 213-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000152
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 112-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000102
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 12 Region: 171-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000749
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011232917.1.58354
Sequence length 704
Comment PREDICTED: zinc finger protein 132 isoform X1 [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MDPGQPIHWPPGLVLSSLQSPVTFEDVAVYFSKEEWGLLDASQRHLYHNVMLENFELMTS
LGCWHRVEDEGAHSKQNTSVEGMSQVRIPSANPSTQKADTCDMCGPFLKDILHLDEHQGT
YPEETLYTCGTCGREFWFSANLHQHQKELSGEKPFRWDKDKDSFVENLTVHLSEKPFTCE
EGGRDALDTHDFFQHSAIDSSRKPQRTTDCRETFSHSSNLEQLPEVHTTQKLFKCSNCGK
AFQKTSTLLNHLRTHSKETPFRCPTVGNSLEEKSTLVNHQKYHDRETCHVCKACGKTFSH
PSKLRKHQKFHTRVKHYECSDCGKTFNRKLTLVHHQRIHTGERPYECSECGKAFNKRSHL
TRHEKVHTGERPFECSKCGRAFSQSSNFLRHQKVHTQVRPYECNQCGKAFSRSSALIQHW
RVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECSECGRDFSQSSHLLRHQKVHT
GERPFECTECGKAFSNSSTLIQHQKVHTGQRPYECSECRKAFSRSSSLIQHWRIHTGERP
YECSECGKAFAHSSTLIEHWRVHTRERPYECSECGKFFSQNSILIKHQKVHTGERPYECS
KCGKFFSRKSSLIYHWRVHTGERPYECSECGRAFSNNSYLVRHQRVHTQERPYECSQCGK
AFSERSTLVRHQIVHTRERTYECGHCGKIFSRLCNLAQHKRIHN
Download sequence
Identical sequences XP_011232917.1.58354 XP_019663371.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]