SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011235266.1.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011235266.1.58354
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 6.67e-86
Family Integrin A (or I) domain 0.0000000484
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-25
Family Integrin domains 0.00028
Further Details:      
 
Domain Number 3 Region: 622-705
Classification Level Classification E-value
Superfamily Integrin beta tail domain 5.49e-18
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000455
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000865
Family Integrin beta EGF-like domains 0.002
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.00000628
Family Integrin domains 0.0023
Further Details:      
 
Weak hits

Sequence:  XP_011235266.1.58354
Domain Number - Region: 505-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011235266.1.58354
Sequence length 788
Comment PREDICTED: integrin beta-6 isoform X3 [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MGTELLCLFFLFLGRTDHVQGGCAMGGAETCEDCLLIGPQCAWCSQENFTHPSGVGERCD
TPATLLAKGCQLTFIENPVSQVEIHTNKPLSVGRQKNSSDIVQIAPQKLTLKLRPGSEQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGVLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTATCNNGVLFPQQKKCSHMKVGDTASFNVT
VSIPNCERRSRHIIIKPVGLGDALEILVSPECNCDCQKEVEVNSSKCHNGNGSFQCGVCA
CNPGHMGPRCECGEDTLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDNGVCDCGECVCRPGWAGEYCNCTTSTDSCVSEDGVLCSGRGDCICG
TCACTNPGASGPTCERCPTCGDPCNSKRSCIECHLSADGQAQEECVDKCKLAGATISEAE
DFSKDSSVPCSLQGENECLITFLITTDNEGKSIIHSISEKDCAKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KMDLSTDG
Download sequence
Identical sequences G1M1V6
XP_011235266.1.58354 ENSAMEP00000013317 ENSAMEP00000013317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]