SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011238043.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011238043.1.92730
Domain Number 1 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-25
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 506-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 6-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-22
Family KRAB domain (Kruppel-associated box) 0.00016
Further Details:      
 
Domain Number 5 Region: 561-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 603-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 10 Region: 117-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 11 Region: 190-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000454
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 62-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000851
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011238043.1.92730
Sequence length 673
Comment PREDICTED: zinc finger protein 442 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MSAANAQGVVTYDDVHVNFTQEEWALLDSSQKNLYRDVMLETYRNLAAIGYSWEDHNPEE
HFQSSRRHGRHEKSHIEEKPSEFTQCGKVFAYQSHPQGHQQIHTGEKPYEVIQYLEAFAY
HSSLQIHKRTHGGDKHYKINECGKAFACHNSLQRYKRVHTGEKLYECNQCGTDFAQHSHL
QQHERMHTVKCKQSGKDFACYTNLQIYQRTHTGEKPYECIFCDKTFIHHSHLERHERIHT
GEKPYECNQCGKAFSQNSSLQLHKRTHTGEKPYECKQCGKSFACQSGLQQHKKTHHGEKS
YECKRCGKAFACQSDLQQHKRTHTGEKSYECNQCDKAFALRCHLRRHQRIHTVEKPYKCN
QCGKFFAQSNHFVRHKRTHTGEKPYECNQCDKAFACQTSLLYHKRTHSGEKLYVCNECGK
AFVLQSYLQIHKRTHTGEKPFGCDQCDKAFAQNSHLLTHKRTHTGEKPYECEQCGKAFAS
NSNLQVHKKTHTGEKPYECKQCGKAFGFQSGLQKHKRTHTGEKPYECNQCDKAFACQASL
LNHKRSHTGEKPYECSECGKAFVLHSYLQIHKRIHTGEKPFECDQCDKAFARNTLLLKHK
RIHTGQKPYGCKQCGKAFANHSNLQVHKRTHTGEKPYECKHCGKPFKCQSGLQYHKRTQH
IQERNPMTVINVI
Download sequence
Identical sequences XP_011238043.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]