SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011241806.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011241806.1.92730
Domain Number 1 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-26
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-24
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 196-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 3-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-20
Family KRAB domain (Kruppel-associated box) 0.00022
Further Details:      
 
Domain Number 7 Region: 560-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.88e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 154-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000536
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 85-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000105
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 10 Region: 383-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000165
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 467-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000508
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 12 Region: 243-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000682
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011241806.1.92730
Sequence length 639
Comment PREDICTED: zinc finger protein 873 isoform X1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAAVTYEDVHVNFTHEEWALLDSSQKSLYKDVMLETCRNLTAIGYRLEDHNIEEHCQSSR
RPGRYICNCGYKPCENEDHGKKQCSFACNSFLQMYERIYNEEKAYECNQYSKAFVNFHSL
PQHAKNHPREQPYECNHCGKAYVSPSSQIHKRSHVGEKPYECSKCGKAFENDNHLQNREK
HHTLEKLFECSQCGKAFASRSYLPIHRRIHTGEKPYECTQCGKAFTSRSYLKIHKSVHTG
EKPYECNQCSKAFANFYSLRQHEKYHTREKPYECSHCSKAFPSPSSLQVHERTHTGEKPY
DCTECGKAFISHSSLQIHKRVHTGEKPYECTLCGKAFVNRSYLEVHKRIHTGEKPYECSQ
CSKAFANFRSLRQHEKNHTREKPYECSQCSKAFVSPCHLQIHQRTHTGEKPYDCSDCGKA
FTRLSNLQVHKRTHTGQKPYCCSQCGKAFPCFSNLQIHERTHTGEKPYACNQCGKAFASR
ASLQYHEKHHTGEKPYGCNQCGKAFVSPSHLQIHQRTHTGEKPYECSQCGKAFARRSNLQ
IHERSHTGEKPYDCNQCGKAFASRASLQYHEKHHTGEKPYGCSQCGKGFALRSLLQVHER
THTGEKPHQCTQCDRSLAWLSPERLHRQLTEADADTAKH
Download sequence
Identical sequences XP_011241806.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]