SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011246197.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011246197.1.92730
Domain Number 1 Region: 40-289
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.06e-61
Family Leukotriene A4 hydrolase catalytic domain 0.00000412
Further Details:      
 
Domain Number 2 Region: 298-442
Classification Level Classification E-value
Superfamily ARM repeat 1.04e-36
Family Leukotriene A4 hydrolase C-terminal domain 0.0013
Further Details:      
 
Weak hits

Sequence:  XP_011246197.1.92730
Domain Number - Region: 14-34
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.00248
Family Leukotriene A4 hydrolase N-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011246197.1.92730
Sequence length 494
Comment PREDICTED: arginyl aminopeptidase-like 1 isoform X3 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MSATQSVYVEEEGLYHFHMEHPVPAYLVALVAGDLKPADIGPRSRVWAEPCLLPTATSKL
SGAVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTFIISSILESDEFLVIDV
IHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAAFTCLETAFRLDALHRQM
RLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGGPQRFDDFLRAYVE
KYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTR
PVEALFQLWTAEPLEQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYS
SLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFAL
EVFYQTQGRLHPNLRRTIQQILSQGLGPSAEPSTEPSTDLGGAEADTNPDSPALLLGDEA
PSSTISLRDVNVSA
Download sequence
Identical sequences XP_011246197.1.92730 10090.ENSMUSP00000027487 ENSMUSP00000027487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]