SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011251854.1.72520 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011251854.1.72520
Domain Number 1 Region: 26-96
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000706
Family Tachycitin 0.002
Further Details:      
 
Domain Number 2 Region: 100-163
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000471
Family Tachycitin 0.033
Further Details:      
 
Domain Number 3 Region: 162-221
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000149
Family Tachycitin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011251854.1.72520
Sequence length 231
Comment PREDICTED: peritrophin-1 [Camponotus floridanus]; AA=GCF_000147175.1; RF=representative genome; TAX=104421; STAX=104421; NAME=Camponotus floridanus; AL=Scaffold; RT=Major
Sequence
MKRVYVIASLALWTVVNANYEWHLKCPVTQCKCPEKYATNLPHETDCTKFYKCDWCRPVL
QNCSLSGIPGYERLHYNRRLQVCDWPWQAGCESCTKPEVDKCSYENEKISNPKDDCNTYF
ECKNGKPRLCRCDPGTCFSRTCQACVEDRAGGNCGPPTTPGPWPCKKGERKCHDCNCRSY
YECKQIEGDATGWFLQYCEGGLYYNPDIQECDDANNARPICEAKCLHKDDS
Download sequence
Identical sequences E2A5C4
Cflo_02905--XP_001122292.1_APIME XP_011251854.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]