SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011251921.1.72520 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011251921.1.72520
Domain Number 1 Region: 21-265,336-385
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.51e-104
Family Type II chitinase 0.00000097
Further Details:      
 
Domain Number 2 Region: 265-335
Classification Level Classification E-value
Superfamily Chitinase insertion domain 8.64e-23
Family Chitinase insertion domain 0.00026
Further Details:      
 
Domain Number 3 Region: 420-480
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000837
Family Tachycitin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011251921.1.72520
Sequence length 481
Comment PREDICTED: chitinase-3-like protein 1 [Camponotus floridanus]; AA=GCF_000147175.1; RF=representative genome; TAX=104421; STAX=104421; NAME=Camponotus floridanus; AL=Scaffold; RT=Major
Sequence
MNCWIFIFALAALASAAHSEKKIVCYFGSWAVYRPSDGKFDISDIPSDLCTHFIYSFVGL
TTDANVKVLDEWLDLPNNGGKNAFGRFNKLREQNPGIKTLIAIGGWNEGSTKYSQVVASQ
TLRTKLVKSMVEFTMKYGFDGLDIDWEYPNQRGGKPEDVQNFVKLLQELRPEFDKHKLLL
TAAVAAAEPSASLSYDIPAISKYLDFINVMTYDLYGPWDKTTGLNAPLYSGHGSFELKLN
VDACVRYWLKNGCPPEKLIVGVPSYGRTFTLANKNEYGLGTPARGPGTAGPYTREAGMLG
YNEICVLIKEGGWTITRSEGHDVPYAFKNDQWISYDDVTSLNEKANYINSLNLGGAMIWS
IETDDFRGKCGKQYPLLKTLNAKLRGKVIPIEPSKPTDSPKETNPPKPSTVQPTQPPATA
PPNGICKKVGYVRDKEDCNVFYQCLDINGTYKIEKFNCPSGLGFDDKSNVCNYKKFVNGC
I
Download sequence
Identical sequences E2A5G4
Cflo_09529--XP_397146.3_APIME XP_011251921.1.72520 XP_011251922.1.72520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]