SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011277890.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011277890.1.62641
Domain Number 1 Region: 89-513
Classification Level Classification E-value
Superfamily Sema domain 7.85e-98
Family Sema domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1385-1511,1708-1865
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-39
Family p120GAP domain-like 0.041
Further Details:      
 
Domain Number 3 Region: 965-1054
Classification Level Classification E-value
Superfamily E set domains 7.26e-16
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 4 Region: 873-968
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000127
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 5 Region: 516-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000235
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1053-1162
Classification Level Classification E-value
Superfamily E set domains 0.00000378
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011277890.1.62641
Sequence length 1927
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-B3 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MSRTGKSAEAECQRVGASGRGAALCPSPPPWAGQTEEMGLPRRHAAQETPLSLLFKAVPV
MAPRPPLGPHLLLVLLLCPPPPLAEARHFSAPNTTFNHLALAPGRGTLYVGAVNRLFQLS
PELQLEAVAVTGPVFDSPDCVPFRDPADCPQARLTDNANQLLLVSGRAGELVACGQVRQG
VCEKRRLDDVAQVLYQAEDPGDGQFVAANAPGVATVGLVVPTPGRDLLLVARGLAGKLSG
GVPPLTVRQLAGPQPFSSEGLGRLVVGDFSDYNNSYVGAFANARSAYFVFRRRGARAQAE
YRSYVARLCLGDANLYSYVEVPLTCQGQGLIQAAFLAPTTLLGAFAAGPSGAQAALCAFP
LAELDGSMDRARRLCYTAGGRGPSGTEEASVEYGVTSRCVALPPDSPESYPCGDEHTPSP
IAGRQPLEARPLLQLRQPISAVTGLQADGHTIAVLGDTQGQLHKVFVNGSRGQVYHSQQV
GLLGSAISPDLLVDGRGSHLYVLTAQRVDRVPVAACPQFPDCASCLQARDPLCGWCVLQG
RCTRKGQCDRAAQANQWLWSYEDSHCPHVQTLLPAHRPRQEQGVVTLSVPRLPTLAMDEY
FHCAFGDYDSLAHVEGPHVACITPPQDQLPLNPPGTDHVTLPLALMFEDVAVAATNFSFY
DCSAVQALEAAAPCRACVGSLWRCHWCPRSSRCVYGEHCPEGEVTVYSAQETDVQVRGPG
ACPLVEGPAGPLLVPVGWESRLALRVRNLQHFGSLPASYHCWLELPGELRRLPASLEETA
GDVGLIYCQAQQFYPSMAQQELPVPIYITRGKGQRLDNAHALHVTLYDCAVGHPDCSRCQ
AANGSLGCLWCSHGQPACRYGPLCPPGAVELLCPTPSIDAIEPLTGPPEGGLALTIWGSN
LGRDFAEVRDAVNVAGRPCSPEPSLYRTSARIVCVTSPAPNGTTGPVQVAIKNRPPGVST
QHFTYQDPVLLSLSPQWGPQAGGTQLTIHGQHLQTGGNVSVFVGGQPCPIREPVCPEAIV
CHTMSQASPGEAVVRVVFGHAQRTLPASPFHYTANPQLVAAEPSVSFRGGGRLIRARGTG
LDSTPTRSCGAPAAAPQACIQLEGGLLQCSTVCSVNSSSLLLCQSPAVPDGAHPQRVFFT
LDNVHVDFASASGGQDFLYQPNPRLAPLSREEPARPYRLKPGNVLDVEGQGLNLGISKEE
VRVHIGDGECLVKTLTLTHLYCEPPSRAPQPANGSSSLPQFVVQMGNVRLALGPVQYETE
PPLSAFPVEAQVGLGMGAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLENLEIGVGDQ
CRKEFTDLMTEMTDLSSDLEASGIPFLDYHTYAERVFFPGRGGCPLQPAPEGPGEEGRRA
PVRQGLTQLSNLLNSKLFLLTLIHTLEEQPGFSQRDRCHVASLLSLALHGKLEYLTDIMR
TLLSDLAAHYVHKNPKLMLRRTETMVEKLLTNWLSICLYAFLKEVAGEPLYMLLRAIQYQ
VDKGPVDAVTGKAKRTLNDSRLLREDVDFRPLTLMVLVGPRAGGTAGSGAAQRVPARVLD
TDTITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRL
NTLQHYKVPDGATVRLIPQLHKGGAVSQSLAQSCPLGENTPMLEDGEEGGVHLWHLVKAT
EEPEGAKARRSSLRERERERARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPVP
IAVKYLFDFLDELAEKHGIEDPETLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAI
LAVIAQTFIDSCTISEHKVGRDSPVNKLLYAREIPRYKQMVERYYSDIRQSSPASYQEMN
SALAELSGNYTSVPHCLEALQELYNHIHRYYDQIIGALEEDPVGQKMQLACRLQQVAALV
ENKVTDL
Download sequence
Identical sequences XP_011277890.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]