SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011283545.1.62641 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011283545.1.62641
Domain Number 1 Region: 359-425
Classification Level Classification E-value
Superfamily RING/U-box 4.18e-20
Family RING finger domain, C3HC4 0.0041
Further Details:      
 
Weak hits

Sequence:  XP_011283545.1.62641
Domain Number - Region: 288-298
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00178
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011283545.1.62641
Sequence length 431
Comment PREDICTED: RING finger protein 44 isoform X3 [Felis catus]; AA=GCF_000181335.2; RF=representative genome; TAX=9685; STAX=9685; NAME=Felis catus; breed=Abyssinian; AL=Chromosome; RT=Major
Sequence
MRPWALAVTRWPPSAPVGQRQFSVGPSSTPGQLRGSPSREGPLASLPAQDEHLPSQQPPS
RPHLPVEEHRASAPAGRSPRMLHPASQQSPFMVDLHEQVHQGPVPLSYTVTTVTTQGFPL
PTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPLIQACTMQQLPVPYQAYPHLISSDHY
ILHPPPPAPHPQPAHMAPLGQFVSLQAQHPRMPLQRLDNDVDLRGDQHPLGSFTYSTSAP
GPALSPSMPLHYLPHDPLHQELSFGVPYSHMMPRRLSTQRYRLQQPLPPPPPPPPPPPYY
PSFLPYFLSMLPMSPTAMGPTISLDLDVDDVEMENYEALLNLAERLGDAKPRGLTKADIE
QLPSYRFNPDSHQSEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCVDKWLKANRTCPICR
ADASEVPREAE
Download sequence
Identical sequences A0A2I2UM26
ENSFCAP00000020348 XP_011283545.1.62641 XP_019305927.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]