SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011309014.1.61867 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011309014.1.61867
Domain Number 1 Region: 555-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 148-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000115
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 298-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000167
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 472-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000461
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 609-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000135
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 526-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000118
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 412-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000186
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011309014.1.61867
Sequence length 1048
Comment PREDICTED: zinc finger protein 91 [Fopius arisanus]; AA=GCF_000806365.1; RF=representative genome; TAX=64838; STAX=64838; NAME=Fopius arisanus; strain=USDA-PBARC FA_bdor; AL=Scaffold; RT=Major
Sequence
MDVSGDLTLQWVEEVGNVIHEEVICGLEADLETQEGEVIGACEEVCIEDDGQGGSEQETT
HSLPPDTEILMVPQSSDMESIYIVPQDQGHDYLNIQVTEEVITDNWDRSGPEDGVEIPET
KVSHDNLLEYDDMEIPLPIDQDSYTNTRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHGC
NLCGARYVRKCDLMNHLKIHAYAPTRDGLEDDLQSEDLPDDDDPPKGRRKKPQAPRKRKA
LPKRPLNPLDSTLDHTDKLPHSKLQKSFDYVDEDMRLLEEMTTRPNSSPRWPITDPTKPY
VCQYCGVGFAREKALASHARIHGGDSPFECTNCGDMFWDVNALRDHIRIKHGVTQSPIDE
FDTAETPYTGDERFGEFYCETCGVPFHRLDLLKRHRKIHVKQETGGEQVDSGNHHVCNVC
GEWFEEALALLAHAELHARSPTRRCLLCGERCRDDAEVAEHVRLIHGDDAPPNTCTLCGK
TCKDKRSLLKHSWVHNTDKTFGCTKCGKRFHSKARLRRHMVSHRNKMVACDECGEEFPDG
RALVSHRHSHNKELGGRSFPCRECGKTFGSRSSQQIHIRIHTGERPYGCRFCWKAFADGG
TLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPDPKCHGSLTPYLCKVCGDS
FGSSEEIILHIVQHCDDNTALRRQPQVGPRKYKRRRKLKPHESPIVTQRSEFDGAELSES
DENSKRKAKRSNKRSLDEGYQSVLKSFESSIQNINSIVSSSKASKSGKVKKKMKKEEKKA
PESSATSNSGRPKMIHTQKTRVPVEVGSDGAKKGQKTKTMVTRTPKVMPGERGMFPGGER
NRPRTKNVSYHVDGRNVIPATFPQVNNEIVETMEQTPEPMQEFVQVNVKTEPHMITRRSA
ANHSNGSSIGVRDVEIKKRVRKGVKKMNRGIKIEPREEILEEHIPEEDIAEEVVDEVPKV
AMEMEVGFEETIEENGESILPDLDGVHQDIVVPEKVSLRVKVEPATSRGLLEDVPETIIP
DAIEYTCEMCSAVFSSRAELLVHVPIHI
Download sequence
Identical sequences XP_011309014.1.61867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]