SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011317306.1.100342 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011317306.1.100342
Domain Number 1 Region: 1072-1203,1235-1436
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.31e-70
Family p120GAP domain-like 0.00051
Further Details:      
 
Domain Number 2 Region: 305-462
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.63e-37
Family Calponin-homology domain, CH-domain 0.0000217
Further Details:      
 
Domain Number 3 Region: 1658-1756
Classification Level Classification E-value
Superfamily RGC domain-like 2.35e-25
Family RGC domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011317306.1.100342
Sequence length 1757
Comment hypothetical protein FGSG_01497 [Fusarium graminearum PH-1]; AA=GCF_000240135.3; RF=representative genome; TAX=229533; STAX=5518; NAME=Fusarium graminearum PH-1; strain=PH-1; NRRL 31084; AL=Chromosome; RT=Major
Sequence
MSSRTHYFQSQHQTQSQSPSQPLPHQHLRPFRQSHTIDFASNSNVSPALVNRFPSTTSSS
ASSGYSHGSDHSFNSQYTSASSSAGYGATVHGHKRAQSDVRARAKTFETGENMTSKKAPD
NIYNSARHSLRPLPQAPAGTRPDTPPNARHDRTKSVDIGKLSISHMGQISPTKGSPTKTS
PLKTSSPSRPLPMRPNSMLLTRSDSFLPQENTLSPLSPHHVHSTHIARDELEGLGKSSTS
QLRTLSRLVSSDSPEDFTITSPTQEVVGLRGRRRLQRGDRSNTGPSQKNTGYSWEGRNWM
DKQRQFLQAYEYLCHIGEAKEWIEDVIHKNIPPIVQLEEALRDGVTLAEVVESLNPDRRY
RIFQHPKLQYRHSDNIAIFFRYLDEVELPDLFRFELIDLYEKKNIPKVIYCIHALSWLLF
RKGIVDFRIGNLVGQLEFEHHELEAMQKGLDKLGVTMPSFGNMSADFGVPEPEPEPEETE
DERIARELKENEESIVDMQAQIRGALLRVKLGDTMQQLWDSEEWLIDLQSRIRGDFTRQI
MDYRLQMKRFAIQLQSSARGFLVRRRFNRREQILEALEPDILELQTMIRANKVRNQVRDT
SAQLAKCRGPIREIQAISRGFLARKSHVAQYEETKESSGMVEKLQAAVRGALLRGKVGQD
LEDLEMQTPAIVDLQAAARALLTRNQVDRELHHLKSSGPKWEKLQAFARGFRAREDDKAL
RSELKKHIPDIEQLQALARGLAVRQNDQALRAELNEHAPAVERLQAFARGLRARQEDKAL
RSELDKHTTNVEQLQSFVRAAAVRRDVADTLDALKENEPAVIDLQALIRAMLERQRVAVI
LEQLEEQVPEVTTLQSHIRGFLYRKQHEAFLEELDSHTPQIVDLQSILRAMMERARVEDI
MAELEQEEESIIAFQAAANGFMVRARFEEKKRFYNENMQKVIKIQSFVRAKVQGEAYKSL
TTGKNPPVNAVKNFVHLLNDSDFDFNEEIEFERIRKTVVQQVRQNEMLENYIDQLDIKIA
LLVKNKITLDEVVRHQHNYGGNSMHFIANSSMSSANQFDLKALNKSSRKKLESYQQLFFN
LQTQPQYLARLFKRIREQGTAEKECKRIELLMMGLFGYAQKRREEYYLLKLISRSVREEI
SCARDVQDFIRGNFFWSKLLNNYTRSPRDRKYLRDLLGPLIRDNIVEDPALDLESDPMQI
YRSAINNTELATGRPDQRPLDVPREVAIRDPETRQLFIDHLRDLRDICDQFFLALEDFLH
KMPYGLRFVCNQIFENLRQQFKREPPENLLQVVANWLWRFYLQPAVIAPENVGVIEKSLS
PLQKRNLSEVAKVISQIATGRPFGGDNVYLQPLNAFVAESVERLLQITSDVIAVPDAERT
FDIDEFNDLYAKNKPTLYIKMTDVFSIHNLVAAELQTMCPSRDDILREIMHELGSAKSNE
NEMNAAGSSDIHMFLTPKLHETDDPEADVKALFMETKRCVLYIIRVQTGTNLLEILVKPI
SPEDDHKWRMLLHDEFSVGSNTRGAYSDSNMIDVTRMSYQELKRTALENIMRLEKLGRIT
KHNYYQDVLNAIALDIRTKSRRRVQRQRELEGVRLTLNNLHEKAKYLEQQRKSYDDYIES
AMATLQNKKGRKRFLLPFTKQYNHQRELERSGRVPKFGSYKYSARALSEKGVLVSWSGIT
DFEKINLTLSCDEVGVFSLEGSRGHIQIPGASALMPIEDLLQAQFEAHQFMTLFEGSLKL
NVNLLLHLLYKKFYRTQ
Download sequence
Identical sequences A0A2H3G4U6 I1RD10
5518.FG01497.1 FGSG_01497T0 XP_011317306.1.100342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]