SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011330770.1.87679 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011330770.1.87679
Domain Number 1 Region: 87-217
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.68e-32
Family Regulator of G-protein signaling, RGS 0.0000861
Further Details:      
 
Domain Number 2 Region: 732-811
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-28
Family DIX domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011330770.1.87679
Sequence length 813
Comment PREDICTED: axin-2 isoform X1 [Ooceraea biroi]; AA=GCF_000611835.1; RF=representative genome; TAX=2015173; STAX=2015173; NAME=Ooceraea biroi; AL=Scaffold; RT=Major
Sequence
MKAMIDRMSASRQNEARCFNENSPRPPVPGEETESYVSRIRPQSPALTSRRSAFTTSQIS
DGGCDASAPRGFEPEGCCGTTTMESNSLPAYARWARNLHSLLQDPVGLELFKRYLDQEGH
VDPLNFWFACEGLKEQKNAEKISQLVKLIYRRFFLKSQLTIPEDVMKEADRRVKEGRADQ
KVFDIVQLEVERLINETTYPNFLQSDVYLQYVQSYQNPESGGCPSSSSGSREMSISCGPS
QLPTVHEDSEYVGSVHNSHSTGGTPGELRLTKDVLMATQQSRAMDLRPRPEAYAGIYLQH
GTSPYHMHVTRLHAQYSSYNPVSRQDSELQSLSSDARTEVDNMSLNDGSIDGTSSKQKSK
KQYMKQSSSRAIKESASINRESMAHHVVPRTQRMAFPKQMPAKQFAEMLTQKLEILAREQ
KTQEKLDRYLQENDASVGNEAATETANTHKSLGDALREKLSIEEDSDQAILDEHVSRVWS
DQTPSRSPRHSPERRRPTHNYPRPYKQRKEKDMDSTFSVDSGNIHDFQESSDLVGASSMS
SLGSHLSKSKSVPSDYADSLHKQDMHQGHEQRFRRSDMTRRSATKKSMTELTDSGVSVVS
DGTPSLNKDIRLANRFKETDKKVDLKYSGRHGKRYGSRSGSLERPNREAWSMEVPAQPFV
SVLGMPPLSAPYTHIQLEETCRRLEQENKSRASCKQRHLNVSKQTYEPVSQSQLYFQSNE
STLRKPKQEAGDFTTVVFSFCDEQFPYRTKIPGHNVTLKQFKEYLPKKGSYRYFFKTECE
DLDTKVIQEEITDDSEILPLWEGKVMAQVKALE
Download sequence
Identical sequences A0A026WSX6
XP_011330768.1.87679 XP_011330769.1.87679 XP_011330770.1.87679 XP_011330771.1.87679 XP_019885989.1.87679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]