SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011352241.1.87679 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011352241.1.87679
Domain Number 1 Region: 605-732
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-36
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-20
Family PDZ domain 0.0078
Further Details:      
 
Domain Number 3 Region: 919-1001
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.01e-18
Family Ras-binding domain, RBD 0.0079
Further Details:      
 
Domain Number 4 Region: 193-303
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000287
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 5 Region: 863-929
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000103
Family Ras-binding domain, RBD 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011352241.1.87679
Sequence length 1312
Comment PREDICTED: regulator of G-protein signaling loco isoform X1 [Ooceraea biroi]; AA=GCF_000611835.1; RF=representative genome; TAX=2015173; STAX=2015173; NAME=Ooceraea biroi; AL=Scaffold; RT=Major
Sequence
MHHNRRKKKRVNYGVRAVEVIRGAKGFGFTISGQQPCILSCIVQGSPAENAGLRAGDYLV
AVNGHNVSKVPHDDVVHLIGNSKGVLRLQIAENYYSDSSDEEGLATVRSKPKYAHKPRAS
NVSALQLQCRAAKVVRDLQSGAMFQVGGAALENKDHYSSYSGLQYRWNMTSPLPPPPPPV
SHKRDSEKIVHRTVVGYLGTIDIPNQLHPSCMMQVLRKCIKRLKAEKRNPTTVLLTIHVA
NIKLTNSENRVIAEYPSYRIIFCNSFSEQDKQYFGILTKSMKNTDDIVSNSCHVFTIYYK
LIDHQVHSSVCNVFGFTCTKSSELNVCQEFPDSCTSLIGAIQTLYISDCTNGEMNPYNEA
RVRLDTASPQPSNVSTSTAHSSNSDSGIGFKDDYGSCSGKNTANADCARRRQCPNMQYKN
ARSSRDQSVNDAAGHRLTVRATSEARWSKELKLDLSKGMRVVGSGDGTTTTCMGTSAVAA
CSALASTSVGSLASVCTTALFDGIEDAPESTKSASEKLKRLMDTTNKLSPKVYCGQVHKS
LVHSLEDINSSMEYARPPFCHSHSGKPDKPRPWGSLQEIRNFRSSASDNCIYGSTESCDK
SNDCKGVHTWANGFEKLLEDPKGLQTFAVFLKKEFSHENIYFWAACERYKDTKDIAARRR
LACQIYQRHLSSTAAEPVNVDSHASGQITQELLDEAPADLFLQAQKQVFNLMKFDSYPRF
LRSELYRSCLESGSAIVDTEDCDLQVTSSPSVKLKKSHSDAEDRCRKSILPWNRKNRSKS
KDRGESEYNKVPSRSETIYKSFTVIKRETEGNNNEDSVSISSSRSSLASWDLALRQSFNK
HSVLSCDGQTNEKKDARGKCTGLCRVILPDGSTTVVTTSQTETIKDVVTRLLDKRALRYS
NYDVLILATDEMVDTKCFSSVLAGQEVEVVLTKVLKVELPSRRIISVVTHKGKTLKEVLR
PLLNKYGFNLDLISIWSEGHCVPMDIMAINAPTRLIVVANEEDLQRELHTAKYLDQVPHV
QQTLDEITNRVFEELLVGKSKNKYQYSEGSCKSDDQRSEGSSVLSSKFFLRDSTIHGKKK
AKSKCCNTSEKGSTNDCAHEGVPVIKSQPPLIAKWRNGVKLQLPGRFDGDDLYEGLKRAQ
RSRLEDQRGTEINFELPDFLKNKENGKSSDSNKMRRTRVMSANCEGTTKFYDSSEDRQSC
SGYEYPTHVANGAANQRISAVVNITEPLSKCLDNSFTLDGDRTLVDADQTIIENGTNSQS
RSPHSASYSMGAKLSKPPPLPPKPKNLVVNVVKSGYIMSPKTTLQRPNHVIE
Download sequence
Identical sequences A0A026WXW8
XP_011352241.1.87679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]