SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011361771.1.92234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011361771.1.92234
Domain Number 1 Region: 425-590
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.14e-70
Family A middle domain of Talin 1 0.0000003
Further Details:      
 
Domain Number 2 Region: 690-825
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.67e-53
Family I/LWEQ domain 0.00000217
Further Details:      
 
Domain Number 3 Region: 595-719
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.28e-51
Family I/LWEQ domain 0.00000499
Further Details:      
 
Domain Number 4 Region: 2187-2377
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.59e-51
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 5 Region: 1731-1865
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 8.63e-47
Family VBS domain 0.0000071
Further Details:      
 
Domain Number 6 Region: 1118-1254
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.41e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 7 Region: 974-1100
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.02e-26
Family VBS domain 0.012
Further Details:      
 
Domain Number 8 Region: 1362-1448
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000126
Family I/LWEQ domain 0.0089
Further Details:      
 
Domain Number 9 Region: 197-297
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000432
Family Second domain of FERM 0.0000538
Further Details:      
 
Domain Number 10 Region: 1897-2024
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000282
Family VBS domain 0.015
Further Details:      
 
Domain Number 11 Region: 1589-1707
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000706
Family VBS domain 0.091
Further Details:      
 
Domain Number 12 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000123
Family Ubiquitin-related 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011361771.1.92234
Sequence length 2433
Comment PREDICTED: talin-2 [Pteropus vampyrus]; AA=GCF_000151845.1; RF=representative genome; TAX=132908; STAX=132908; NAME=Pteropus vampyrus; AL=Scaffold; RT=Major
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQVPYLMPRHEDVEESQRSSGL
FRYTEFFHSLKEFLPKEYIKQRGAEKRIFQEHKNCGEMNEIEAKVKYVKLARSLRTYGVS
FFLVKDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEES
VSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRG
HMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEI
HSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAALMDDEVG
SGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGENETDER
FQDVLMSLAKAVANAAAMLVLKAKNVAQVAADTVLQNRVIAAATQCALSTSQLVACAKVV
SPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATDDSELLKQVSAAASVVSQALHDLLQ
HVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVSAMRSD
AEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVATNA
AAQNAIKKKIVSRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKAVADHIP
QLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCA
KNLATSLAELRTASQKLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQA
LKTLAQAARGVAASTSDPVAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAESQQRLAQ
VAKAVSHSLNNCVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAA
DLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKN
ISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNAL
RELETVKGMLDNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVG
IASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPDSS
PSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALD
GDFSEDNRNKCRIATAPLIEAVENLTAFASNPEFVSVPAQISSEGSQAQEPILISAKTML
ESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDG
INRCIRDIEQASLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLVDPIATAARGEAAQL
GHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPK
AQHTHDAITEASQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKG
TFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLALQGQMAAATAE
PEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARTVTEKVSLVLSAL
QAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAENNETFADHRENILKTAKALVE
DTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVA
KALSDLIGATKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEA
TIEYMKQELTVFQSKEVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLS
RKAVSDMLTACKQASFHPDVSEEVRARALRYGTECTLSYLDLLEHVLVILQKPTPELKHQ
LATLSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKP
RAKPKQADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAVDDGQ
WSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQ
DSEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEML
KKERELEEARKKLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences XP_011361771.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]