SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011364098.1.92234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011364098.1.92234
Domain Number 1 Region: 228-482
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.47e-65
Family Eukaryotic proteases 0.000000103
Further Details:      
 
Domain Number 2 Region: 45-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-23
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 192-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000362
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011364098.1.92234
Sequence length 486
Comment PREDICTED: LOW QUALITY PROTEIN: complement C1r subcomponent-like protein [Pteropus vampyrus]; AA=GCF_000151845.1; RF=representative genome; TAX=132908; STAX=132908; NAME=Pteropus vampyrus; AL=Scaffold; RT=Major
Sequence
MPGLRRGNXLWGSPHSTSCPGKMWWLLLWGVLQACPTQGSVLLAQQLPQQLTSPGYPEPY
LKGQESTTVIEAPKGFAVRLVFQEFDLEPSQDCEQDSVTITASGMGPHWFCGQHGSPLGN
LPGQREFVSSGSSLQLTFCAPASSENKTTLLHKGFLALYQAVSINQSQPISQVSRGSETT
RTPGDNPFKTQNHCQEPYYQTMPTGMFTCTAQDPWKETQDREEVPHCAPVCGRPVIPIAQ
NQEVQGSSKAKLGNFPWQAFTNIYGRGGGALLGDRWILTAAHTIYPKDSISLRKNRSVDV
FLGHTKTDELIKLGNHPVRRVVVHPDYHQNESHNFDGDIALLELQHSVPLGPRLLPVCLP
NSETLYRSGLMGYVSGFGVEKGWLTTELKYSKLPVAPREACKAWLQEKQRSEVFSDNMFC
AGNKTWQQSVCQGDSGGVYVVWDDRAHHWVATGIVSWGIGCGKGYGFYTKVLNYVDWIKG
VMDGKD
Download sequence
Identical sequences XP_011364098.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]