SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011368959.1.92234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011368959.1.92234
Domain Number 1 Region: 18-514
Classification Level Classification E-value
Superfamily Sema domain 7.32e-101
Family Sema domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1378-1503,1669-1789
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.18e-29
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 946-1034
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000117
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 4 Region: 855-946
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000724
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 5 Region: 1034-1114
Classification Level Classification E-value
Superfamily E set domains 0.00000000000992
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 
Domain Number 6 Region: 517-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000366
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011368959.1.92234
Sequence length 1833
Comment PREDICTED: plexin-D1, partial [Pteropus vampyrus]; AA=GCF_000151845.1; RF=representative genome; TAX=132908; STAX=132908; NAME=Pteropus vampyrus; AL=Scaffold; RT=Major
Sequence
LLLLLLLGAVRAGALEIQRRFPSPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAE
AAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRR
RGNISAVAVRFPPAAPPAEPVTVFPSMLNVAANHPNASTVGLVLPPAADAGGSRLLVGAT
YTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAK
EQHKLGFVRAFLHPPDPPPGAPSYAYLALNSEARAGDKESQARSLLARICLPRGAGGDAK
KLTESYIQLGLQCAGGAGRGDLYSRLVSVFPARELLFAVFERPQGASAARAAPAALCAFR
FADVQAAIRAARTACFVEPAPDVVAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQH
PLSILQPLKATPVFRAPGLSSVAVASVSNYTVVFLGTVSGRLLKINLNESMQVVSRRVVT
VAYGEPVHHVMQFDPADPGYLYLMTSHQMARVKVAACAVHATCGDCVGAADAYCGWCALE
TRCTLQQDCANSSQQHFWTSASEGPGRCPTMTVLPAEIDVRQEYPGMILQISGSLPSLSG
MEMTCDYGNNIRTVARVPGPAFGHQIAYCNLLPKHQFPPFPPHQDHVTVEMFVRVNGRNI
VGANFTIYDCSRIGQVYPHTACTSCLSTQWPCFWCTQQHACVSNQSQCAASPNPMSPQDC
PQILPLSLAPMPTAGSQTIPVHLANAAFFQSAALECSFGQEEIFEAVWVNESTVHCNQVV
LHTTQKSQVFPLSLQLKGRPARFLDSPDPMTVEVYNCAMGSLDCSQCLGREDLGHLCVWS
DGCRFRGPLQPLPGTCPAPEIRAIEPLSGPLDGGTLLTIRGRNLGRRLSDVVYGVWIGSV
ACEPLADRYTVSEEIVCATGPAAGAFSDVVTVNASKEGKSRERFSYVMPLVYSLEPAMGP
KAGGTRITIHGSDLHVGSELQVLLNDTEPCTELVRTDTSIACTVPGGTLPAPVPVCVRFE
RRGCVRSNLTFWYMWNPVITAISPRRSPVSGGRTITVAGERFHMVQNVSMAVHHIGRQPT
LCKVLNSTLITCPSPGALSNASAPVDFFINGRAYADELAVAEELLDPEEAQRGSRFRLDY
LPDPQFSTAKREKWIKHHPGEPLTLVIHKEQDSLGLESHEYRVKIGQVACDIQIVSERVI
HCSVNESLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVALFV
FCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYK
HFVTRTFFPKCSSLYEERYILPSQTLNSQGSSPVQETHPLLGEWKIPESCRPNMEEGISL
FSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHSKLEYYTSIMKELLVDLID
ASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDA
ITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFC
KNVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAM
SLTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKG
TLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFW
VNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKVSYPNAPLLPPQIMTAL
EANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_011368959.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]