SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011373094.1.92234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011373094.1.92234
Domain Number 1 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-22
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-21
Family KRAB domain (Kruppel-associated box) 0.00046
Further Details:      
 
Domain Number 4 Region: 401-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 583-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 179-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 542-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 9 Region: 289-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.66e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000113
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 504-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000451
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 84-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000173
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011373094.1.92234
Sequence length 664
Comment PREDICTED: zinc finger protein 14-like isoform X2 [Pteropus vampyrus]; AA=GCF_000151845.1; RF=representative genome; TAX=132908; STAX=132908; NAME=Pteropus vampyrus; AL=Scaffold; RT=Major
Sequence
MDLVAFEDVAVNFSLEEWALLDSLQKELYRDVMRETFRNLASVGKKWEDHDIEDQYKNRV
RKLRSHMVKRICEGKEGSQCGGNFSLISNLNLKKKILFGRKPQKNSVCGKVFMHHSSHSK
HIRCHTGYKPFEYQKYEEKPYKCNICGRAFSYVQCFEKHERKHNGEKTYKCKECGKAHSS
STSLQIHERSHIGDKLFECKQCGKAYRYYNALQTHERTHTGQKSYECKQCGKAFSSHLGF
QIHERSHTGEKPYECKKCSKAFSCLSYLRSHEKIHTVEKPYECKECGKAFRYYHNYQTHE
RKFTGERPYECKECGKAFRCYQSFQKHERIHTGGKPYECKECGLAYRYYSTLQRHKRTHT
GEKPYKCKQCGKAYRGHSALQTHERTHTGEKPYDCKECGKVFISHLGFQIHERSHTGEKP
YECKQCSKSFSCVSYLRRHEKIHTGEKPYECKQCGLAYRYYSTLQRHERTHTGEKPYECK
ECGLAYRYFSTLQSHERIHTGEKPYVCKECGKTFRWYQSFQTHERNHTGEKPYVCEKCSK
QFSCLRYLRKHERNHTARKRYECKNCNKAFRYPSDLQKHERNHTGEKPFECKQCGKAYKD
QSSLQTHERTHTGEKPYECKECGKAFIYHTTFRRHMTMHTGEKPRKVQNLGKASVIPFPF
ESMK
Download sequence
Identical sequences XP_011373094.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]