SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011373230.1.92234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011373230.1.92234
Domain Number 1 Region: 21-102
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000189
Family Snake venom toxins 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011373230.1.92234
Sequence length 131
Comment PREDICTED: lymphocyte antigen 6E-like [Pteropus vampyrus]; AA=GCF_000151845.1; RF=representative genome; TAX=132908; STAX=132908; NAME=Pteropus vampyrus; AL=Scaffold; RT=Major
Sequence
MKVFLPVLLAALLGVEQARSLVCFACTNQNSNFYCLKPTVCSDSDKYCVTVSAAAGIGNV
VDLGYSLNKGCSPVCPAPPNVNLGVASMGTHCCQSFLCNISAADGGLRASATMLGLGLLL
SLLTAVLRLGP
Download sequence
Identical sequences ENSPVAP00000005392 XP_011373230.1.92234 ENSPVAP00000005392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]