SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011376441.1.92234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011376441.1.92234
Domain Number 1 Region: 91-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 53-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011376441.1.92234
Sequence length 225
Comment PREDICTED: zinc finger protein 22 [Pteropus vampyrus]; AA=GCF_000151845.1; RF=representative genome; TAX=132908; STAX=132908; NAME=Pteropus vampyrus; AL=Scaffold; RT=Major
Sequence
MRLGKPKGGISRSSSQGRTSENQRKTGRQRQKWGMTIRFDSSLSRLRRSLDEKPYKCTEC
EKSFSQSSTLFQHQKIHTGKKSHKCVDCGKSFFQSSNLIQHRRIHTGEKPYKCDECGERF
KQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSS
HLRQHTKVHKEEKPRRTRGKNIRAKTHLVSSWKAGTGRKSVAGLR
Download sequence
Identical sequences ENSPVAP00000013882 XP_006908444.1.64745 XP_011376441.1.92234 ENSPVAP00000013882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]