SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011384711.1.92234 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011384711.1.92234
Domain Number 1 Region: 6-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000367
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 43-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 3 Region: 83-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 4 Region: 118-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000805
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011384711.1.92234
Sequence length 152
Comment PREDICTED: notch homolog 2 N-terminal-like protein, partial [Pteropus vampyrus]; AA=GCF_000151845.1; RF=representative genome; TAX=132908; STAX=132908; NAME=Pteropus vampyrus; AL=Scaffold; RT=Major
Sequence
KLCQWTDACLSHPCANGSTCTTAANQFSCQCLAGFTGQKCEADVNECDVPGQCQHGGTCV
NLPGSYQCQCPQGFTGQHCESLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCER
NIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWT
Download sequence
Identical sequences XP_011384711.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]