SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011487640.2.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011487640.2.28442
Domain Number 1 Region: 218-330
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.03e-29
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00058
Further Details:      
 
Domain Number 2 Region: 39-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-18
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 159-215
Classification Level Classification E-value
Superfamily LCCL domain 0.00000000000222
Family LCCL domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011487640.2.28442
Sequence length 333
Comment discoidin, CUB and LCCL domain-containing protein 2-like, partial [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MVGRGPPGAGALALSIFVILTAEGCGAQKGDGCGPSVLGPSSGTLSSRGYPRTYPNNSVC
EWEISVPRGKRIHFRFAFLDIEDNNCQVNYLRLYNGIGTKRSEIGEMTNAHGMGEFECNF
LSIRPSFTFKTFFISGSLRCKWKEKSGVCLNVCPLLALQTSPLCTAAIHAGVVSNALGGR
IHVLSSKGISRYDGALANGVTSTGGNLSNSLFTFRTNGCYGTLGLQTGAVADSQLTASSA
LGAFITGQDSEWGPSGARLKQAGLPWAPSSSNHQQWLQVDLRKEKRITGIITTGSTLREY
PCYVSEYRVLYSNDGREWSTYTEADSTQPKVRP
Download sequence
Identical sequences XP_011487640.2.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]