SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011495573.1.84716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011495573.1.84716
Domain Number 1 Region: 52-510
Classification Level Classification E-value
Superfamily Sema domain 1.83e-119
Family Sema domain 0.0000488
Further Details:      
 
Domain Number 2 Region: 1392-1516,1775-1927
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.97e-41
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 863-953
Classification Level Classification E-value
Superfamily E set domains 0.000000000000035
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 4 Region: 1042-1113
Classification Level Classification E-value
Superfamily E set domains 0.00000000000322
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 5 Region: 512-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000419
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 957-1041
Classification Level Classification E-value
Superfamily E set domains 0.000000000868
Family Other IPT/TIG domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011495573.1.84716
Sequence length 1995
Comment PREDICTED: plexin-B [Ceratosolen solmsi marchali]; AA=GCF_000503995.1; RF=representative genome; TAX=326594; STAX=142686; NAME=Ceratosolen solmsi marchali; AL=Scaffold; RT=Major
Sequence
MSPSGVNRQPLVPPLPRLLVFCYCFVLGWIALVKADEAVKSPPELLQIVAQYPSNVSQLH
FSHLVLDPVTGQLFAGAVNRLLQLNSELELKELLITGPQHDNPQCHASGCPTSLEIETSL
TNNVNKLLVVDLDSRTLIVCGSLFQGACEKHKMSNISIEPENFTFGVAANDETSSTYAFI
GPERYKSWQDSNILYVGTTFTNNAEYRHDVPAISSRRLDTLEFAEYTFNKQSILHIDVKY
RDHFLVKYVYGFNASDYAYFVLVQKQSYLPEEEELGYVSRMARSCITDANYDSYTEVTLQ
CNIEDRNESYRLVQDAKIAPAGGDIAAQFGINVGSPIFVAVFSPSKGITNEPLPRSVVCV
YSLQDIETKFDENIHMCFNSSIKYRNMGYISGPIQDGVCPQAGTTGNIVNFCEVGLKISG
VSPIVGQAVLHFPDTFITSITLANTESHTVAFLGTEDGVVKKALLSATEAKVYESIVVDN
GQKILPDTIVAPDGNYLYVLSNSRISKVKVEHCSSYMNCNSCLVAGDPYCGWCSLEKRCT
IRNDCQKANRSSPRWLSLGTGQQCIDFEQVLPDRIPIKQMTTVQLSIRTLPELPVGAKYK
CVFGEAEPIDAIMTVYGLSCPTPPINLRPSIPKNADHVLVPLAVRSSETNKDFVSRNFAY
FDCSRHTICSECVKAQWTCSWCVYDNKCTHNTTECQGNIISGKNNMQANLAAHGAQYCPR
FVHREKPLMLPNNVPKEISLEVENLPHPQVGHTGFQCFVKIEGAHLRVQARVDSSRYIVC
DKTVYSYEAQLGEYEAQVMVMWNSNHYVDSTNIILYKCEVLGSHREHADCSLCVTRERHF
ECTWCTNSCVYRHSCLNSAFTECPKPRIDMIKPLSGPIEGGTLVTIEGSNLGLRESDVEG
KILIGNTSCILIDYEVSVRIVCRTGRHEATDEAPVIVGNDAGYTKSAVYFSYKDIRLMGL
QPSMGPQSGGTRLAITGQYLNIGSTISAYLNELPCLVNATQASSTRLTCVTSRSDRVRKI
SRLTLSIDGANRTLEGNPYNYTHDPTIMEIKPLSSFAWGGRMITVHGTNLDTIQKPQMIV
YLEKEGAPVNRTVCTVLNPTQMECPSPSVVGRFRGETTSNHRDRLLIRRKDVSLILKVGF
LMDNVESVRDLDKHGQNLRNRLIYVEDPKFFPFPRNIKLYKGDTLVIEGESLNHASDESD
VNVTVGTRPCNVTSLALTQLVCTPPEQQPSGTDEHGTKTEAGLPLVVVRVGRSLRFPIGY
LHYDVLKSYPIPPEAIAGIAAGTFGLIFVFILVLIVYRRKSTQAEREYKRIQIQMDTLES
NVRMECKQAFAELQTDMTDLTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRNN
VTRTNYDAAMLQFEQLINNKCFVLTFIETLESQKDFNIRDKVNVASLLMVVLMGKMEYAT
DILMNLLLRLIDKSVNTKYPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFK
AIKHQIEKGPVDVVTHDARYSLSEERLLREQIDHAHVTLHVMQDDLDEKIQCKVLDCDTI
SQVKFKILDALYKNTPFSLRPSVHEVDLEWRHGRGGHLTIQDEDLTTKCCGDWKKINTLA
HYGVKESAVMSLIPRQNDGFSLACKQSCHTCTKVSQQQLHQHIQQQHSGQQRHLYDSRHA
IDHCTGLHLPQIPSHGIANSTTMYGASTGIFFDNQHSMPMIIANGDVESSHTSSHRLYHL
VRPVEESQYIAGIGFTGGKLPPGLHPERTHKAIPEIFLTRLLSTKGTVQKFVDDFFNTIL
TANDVLPSAVKWLFDLLDEAANKHGILDPEVPHAWKSNSLPLRFWVNFIKNPDFMFDINK
STTVDSSLSVIAQTFMDACSTCEHRLGKDSPSNKLLFAKDIPHYRERVGRFYMEVQRLPL
ITDQEMSSAMQQLSVSHANEFDVIAALKELYIYVSKYYGEILEALETDPGCCKLHLAHRL
ENVACTLEGEETSAC
Download sequence
Identical sequences XP_011495573.1.84716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]