SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011512710.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011512710.1.92137
Domain Number 1 Region: 41-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.17e-40
Family SCAN domain 0.0000412
Further Details:      
 
Domain Number 2 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 247-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 327-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011512710.1.92137
Sequence length 389
Comment PREDICTED: zinc finger and SCAN domain-containing protein 23 isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MAITLTLQTAEMQEGLLAVKVKEEEEEHSCGPESGLSRNNPHTREIFRRRFRQFCYQESP
GPREALQRLQELCHQWLRPEMHTKEQILELLVLEQFLTILPEELQAWVRQHRPVSGEEAV
TVLEDLERELDDPGEQVLSHAHEQEEFVKEKATPGAAQESSNDQFQTLEEQLGYNLREVC
PVQEIDGKAGTWNVELAPKREISQEVKSLIQVLGKQNGNITQIPEYGDTCDREGRLEKQR
VSSSVERPYICSECGKSFTQNSILIEHQRTHTGEKPYECDECGRAFSQRSGLFQHQRLHT
GEKRYQCSVCGKAFSQNAGLFHHLRIHTGEKPYQCNQCNKSFSRRSVLIKHQRIHTGERP
YECEECGKNFIYHCNLIQHRKVHPVAESS
Download sequence
Identical sequences Q3MJ62
9606.ENSP00000289788 gi|190883486|ref|NP_001012458.1| ENSP00000289788 NP_001012458.1.87134 NP_001012458.1.92137 XP_005249007.1.92137 XP_011512708.1.92137 XP_011512710.1.92137 XP_011512712.1.92137 XP_016865968.1.92137 ENSP00000289788 ENSP00000289788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]