SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011529667.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011529667.1.92137
Domain Number 1 Region: 604-663
Classification Level Classification E-value
Superfamily R3H domain 0.0000000000019
Family R3H domain 0.0028
Further Details:      
 
Domain Number 2 Region: 337-416
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000314
Family Double-stranded RNA-binding domain (dsRBD) 0.0079
Further Details:      
 
Domain Number 3 Region: 440-517
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000038
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 
Weak hits

Sequence:  XP_011529667.1.92137
Domain Number - Region: 191-276
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00562
Family Double-stranded RNA-binding domain (dsRBD) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011529667.1.92137
Sequence length 690
Comment PREDICTED: NF-kappa-B-repressing factor isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSKFHARPRFEPV
HFVASSSKDERQEDPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQDGNSQYCDSSGF
ILTKDQPVTANMYFDSGNPAPSTTSQQANSQSTPEPSPSQTFPESVVAEKQYFIEKLTAT
IWKNLSNPEMTSGSDKINYTYMLTRCIQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGY
ACEVRCQNIYLTTGYAGSKNGSRDRATELAVKLLQKRIEVRVVRRKFKHTFGEDLVVCQI
GMSSYEFPPALKPPEDLVVLGKDASGQPIFNASAKHWTNFVITENANDAIGILNNSASFN
KMSIEYKYEMMPNRTWRCRVFLQDHCLAEGYGTKKTSKHAAADEALKILQKTQPTYPSVK
SSQCHTGSSPRGSGKKKDIKDLVVYENSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKC
KVILESEVIAEAVGVKKTVKYEAAGEAVKTLKKTQPTVINNLKKGAVEDVISRNEIQGRS
AEEAYKQQIKEDNIGNQLLRKMGWTGGGLGKSGEGIREPISVKEQHKREGLGLDVERVNK
IAKRDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVV
GRKRRKEDLLDQLKQEGQVGHYELVMPQAN
Download sequence
Identical sequences A3F769 H2QZ19 O15226
ENSP00000304803 ENSP00000360582 HR3512 ENSP00000304803 ENSP00000360582 9598.ENSPTRP00000038260 9606.ENSP00000304803 NP_001166959.1.87134 NP_001166959.1.92137 NP_060014.2.87134 NP_060014.2.92137 XP_003812668.1.60992 XP_009437843.1.37143 XP_011529667.1.92137 gi|291084508|ref|NP_001166959.1| gi|63003897|ref|NP_060014.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]