SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011571944.1.59079 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011571944.1.59079
Domain Number 1 Region: 19-532
Classification Level Classification E-value
Superfamily Sema domain 2.09e-98
Family Sema domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1403-1528,1694-1851
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 966-1056
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000191
Family Other IPT/TIG domains 0.052
Further Details:      
 
Domain Number 4 Region: 876-955
Classification Level Classification E-value
Superfamily E set domains 0.000000000000509
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 535-587
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000484
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1055-1138
Classification Level Classification E-value
Superfamily E set domains 0.00000000369
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011571944.1.59079
Sequence length 1918
Comment PREDICTED: plexin-D1, partial [Aquila chrysaetos canadensis]; AA=GCF_000766835.1; RF=representative genome; TAX=216574; STAX=8962; NAME=Aquila chrysaetos canadensis; AL=Scaffold; RT=Major
Sequence
LLPLLPLLLPGRAAGLEVQRKFLSPTPTNNFALDGPGSRVYLAAVNRLFQLSGGELALEA
EAAVGPVLDSPLCHAPQLPQASCEHPKVLTNNYNKILQPDPEQGVLVVCGSIYQGLCQLR
SMANISAVAVRFPPGGSDPVTVFPSMLNVAANHPNASTVGLVLRRGGGGGARLLVAATYT
GFGSPFFPRNRSLEDHRFENTPEIAIRALNARGDLAKLFTFDINPSDDNIFKIKQGAKAR
HKLSFVRAFLQRGAAPPARRPYAYLALNSEANAGDKESPSHSLLARICLGEAAEATLNGS
GETKKLTESYIQLGLRCGGAADAFTRLVSVFPARAAWRSPAAPAPAPPPAEELLFGVFER
AGAGGGGGGRPQSALCVFRFAEIEETIRAARNSCFVSPSAGMVTVLDSVVQGTGPACEKR
NIQLQPEQLDCGAAHLQHPLAIVNPVTATPVFTYSGLTAVAVASVNNYTVVFLGTASGGL
LKINLDSTMKVISRRSISVAYGEPVHPIMQFDPSDSTYLYLMTSYQMTRVKVAACNQYLT
CTECLAAADAYCGWCTMETRCSLQHECTNFTGANFWASASEGVQQCPSMTILEPEINIDK
ENPALIIQINGTIPNLNGTNISCDYGNNIHTVARVAGDYVNQFIYCSLLPRETYPAFPDD
QDHVVVETALRVNSKNIIRANFTIYDCKRTGNIYPKRACTSCLSTRWKCHWCPSTYTCVS
NHSQCDDALQMKKKIDCPRIVPASLDPMPTGVSRDIMISLANTTFSKETALECHFGTDRT
FEARWVNSSAVECVHVLLHTSEKSHLFPVNLQLKDRPDRFIDSPEMMTVEVYNCATGSAD
CSQCLGREDLGHRCVWSESSSSCRLHSEPSQVSDICPAPEIKKIEPLRGPLEGGTLLTIR
GRNLGRRFSDVLGAVRIGSVQCAPLPDRYVVSEAIVCQTGEAQEAFSDVVAVNVSREGKS
RERYSYVLPVVQSIAPPNGPKAGGTRVTIRGSRLDVGSELRVLVNTSKQCTDLSRNDSTI
TCTMPSAELTTAVRVCVQFENKSCASYNITFKYEKNPIISDINPKKSQISGGRIITLEGR
GFELVQNVSMVVRGIGREQTSCKVHTDTVITCPSPAASNITAGSKPAPVDFYLNGRLYAD
DRPALDEEMYPEEALHISKFSLEYYADPQFFTAKKEKWIKHHPGEPLTLVIHKEPDSLGL
ESNEYQVKIGLISCEIQIVSDKVIHCSVNESLSTSERQLPVTIQVGKFNYTIAMLHLGGG
ETAIIVSIVICSILLVLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAE
LQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEECYILPSQQLSSQVGSQVQE
THPLLVGEWKIPENCRPNMEEGISLFSTLLNNKHFLIVFVHALEQQKDFAVRDRCNLASL
LTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLR
ETVGEPFFLLICAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGM
DSLSVRAMDTDTLSQVKEKILEAFCKNVPYSQWPRVEDVDLEWFATSTDSYILRDLDDTS
VVEDGRKKLNTLAHYKIPEGASLAMSLSDKKDTTLSRVKDLDTEKYFHLVLPTDESVEHK
KSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIRDDKPPVAVKYFFDFLEEQ
AEKRGITDPDTMHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACS
LSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAHLAEESRKYRNE
FNTNVAMAEIYKYAKRYRSQIVAALDANPTTKRTQLQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_011571944.1.59079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]