SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011600897.1.43653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011600897.1.43653
Domain Number 1 Region: 29-512
Classification Level Classification E-value
Superfamily Sema domain 3.53e-103
Family Sema domain 0.00072
Further Details:      
 
Domain Number 2 Region: 1388-1512,1678-1862
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.86e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 857-948
Classification Level Classification E-value
Superfamily E set domains 0.000000000000535
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 954-1028
Classification Level Classification E-value
Superfamily E set domains 0.00000000000726
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 5 Region: 1040-1119
Classification Level Classification E-value
Superfamily E set domains 0.0000000000178
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 6 Region: 514-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000192
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011600897.1.43653
Sequence length 1902
Comment PREDICTED: plexin-D1 [Takifugu rubripes]; AA=GCF_000180615.1; RF=representative genome; TAX=31033; STAX=31033; NAME=Takifugu rubripes; AL=Chromosome; RT=Major
Sequence
MPPSIEIAVLILGVLVLEARRSASALHIQQAFPSPTQTNNFAVDPNSRKVYLATVNTIYQ
LNGTLSAEVEMRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLELDREQGVVVVCGS
VYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSGGNTRLLV
GATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVKDLPRLFTYDINPSEDNVFKIKQE
VKSKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPRKPSGPESRK
LTESYIQMPLQCGFNGNIYNRLLSVYPADIPTEDGREPESHLFGVFSKGDRKSALCAFKF
SDIEEEIRQGREKCSNSPSSDVQVLDSVIQGSGAACVQKGKLTLQLEQLNCGAAHLQHPL
ALRRPLRALPLVEYPALTSVSVDCVHNHTVVFLGTSNGRLRKLTFLANMTLANQWTLKLP
ASEAVHHLMTFDPSDSNYLYLMTSHHMLRVKVAQCDQWRSCGDCLGARDAHCGWCTLENR
CSIQKECALGLLARSWISMGEGPQQCPSMTLTPPEISVSADIKDVGILINGSVPDLLGSR
VECEYGPGVSTSATVHLDSGPAQIQTCPLLPRENYQSILPDTDHQAVSVAIKVNGTSVVS
GSFIIYDCERTGAIHPKTSCVSCLSARWKCYWDQENHLCVSNKDESNLHLIESATSCPSL
LASEVPPAPSGTAQDFTLSLRNVQEGEELECDFGTEQRYEATWVNSSVVKCSGITLFTYH
RSQIYHLNLRRKRFYSGRGEDVFVDSPQPVKVEVYNCKVGSSDCSQCWGREDQGHLCGWC
ENSCKPRDDCQPIVEQCASPEIHKIFPLRGPVEGGTLLTVQGRNLGRRAEAVKVSIGDVP
CSLLPDRYTVSLELVCITGWSADEKTDIVQVDVEQSGTGTSKESFSYLLPKLLYMEPNKG
YHAGGTKVTITGEHLDIGSQVRVMVNSTHECVITEKTDNVIECTMPAVTQAHVSSVSVCV
EFENLPCQRDDLSTTYTYKKNPTIFFIEPTKSYLSGGRTITVTGQGFDLVQSAVMQVEGI
GQTMCSVISNSTIHCPSHSSSESQQTSVRFFLNGVLYTDESSSSSDSEEEEDEEGEDGDP
NKDHFLLEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSDLDLVPEEYSVMIGSYPCN
ISFHNDQLFHCTINGLLGSSERELPVTVQVGNFRHIIAKVQLGGSELAIVVSIVVCCVLL
LLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRS
QGIPFLEYKQFVTRTFFPKMCSDYEKSLVLHAYENDGMGPRALPETHPLLQDWQATNTTK
PNVEEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIM
KDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQ
QINKGSIDAITGKARYTLNEEWLLRENVEARPQNINVSFQGCGMDSLSVRVMHTDTVCQV
KEKTIEAFYKNLPFSQWPRAEDVDLEWLDSGANSKLLQDLDNSSVMEDGRKKLNTVFHYQ
IPEGASLAMSLKDKKENTLGRVKDLDTEKYVHLVLPHDELMETRKSHRHSHRKKVLPEIY
LTRLLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWK
TNSLPLRFWVNILKNPQFVFDIEKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLL
YAKEIPEYKKRVQLYYQQIQEMSPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKR
YRNQVVSALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_011600897.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]