SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011605625.1.43653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011605625.1.43653
Domain Number 1 Region: 39-524
Classification Level Classification E-value
Superfamily Sema domain 1.83e-107
Family Sema domain 0.0000000155
Further Details:      
 
Domain Number 2 Region: 1097-1356
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-78
Family Protein kinases, catalytic subunit 0.000000000901
Further Details:      
 
Domain Number 3 Region: 666-754
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000107
Family Other IPT/TIG domains 0.074
Further Details:      
 
Domain Number 4 Region: 526-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000942
Family Plexin repeat 0.00069
Further Details:      
 
Domain Number 5 Region: 569-636
Classification Level Classification E-value
Superfamily E set domains 0.0000000255
Family Other IPT/TIG domains 0.059
Further Details:      
 
Domain Number 6 Region: 752-843
Classification Level Classification E-value
Superfamily E set domains 0.000000128
Family E-set domains of sugar-utilizing enzymes 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011605625.1.43653
Sequence length 1425
Comment PREDICTED: hepatocyte growth factor receptor isoform X1 [Takifugu rubripes]; AA=GCF_000180615.1; RF=representative genome; TAX=31033; STAX=31033; NAME=Takifugu rubripes; AL=Chromosome; RT=Major
Sequence
MNLCSFPAAVLLLWALSASAEGHCQKSPEPNKLNLSVSYELPTFTAEFPIQNVVTLDGII
YVGATNRIYALAPSLTKLSEYRTGPLLANQTCGQKVANASSGGGRKDNLNVALVVENIYD
KGLFSCGSADNGVCRRHVLEDDVSLDEEGRQKSVDELVYCFTDLKQDKGQPRDSDVVVSP
SGSQVLNVESNMIMFFVGNSEIPGSGNVTGPTARPHTMSLRKMKTSQNGFTFFSNRSYMD
LIPPLRGSYYLRYVYSFHSGPFTYFLTVQQVSKDSQTYHTRIVRMCSSDHDIRRYVEMPL
ECISTDKRRRRSMEDVKVFNILQAATVTKVGSDVELQRQLRLEEGDDVLFAAFARGKPNS
TEATPNSAICVMSLKLINSMFKMYMQKCNTVDLYHFTGSDKKSCYNVSSSDDCDPHEGIH
EGKEGKYRLQVTQFVQRLEYWQKVLTNTLVTSITVVTVHGRAVGYLGTADGRHIQVAFSR
FASPHVNIRLDSRPVSGSVVLPGQDPSEGALLLTTGNKITKVPLIGPGCDHLTTCTSCLV
SSRVTECGWCEGRCTRANQCPPSVWTQEYCTPVVTKVFPTSGPIRGSTTVTMCGRNFGFD
KTESFKASLVTVEVAGVPCKLSRQDYASRWTEIQCSPMFSGNFMPSGHTVKVTSGHKIAT
IEGFTFVDPVVSEIFPTFGPKSGNTMLTIRGAFLDTGNKREVTVGKAACKIQSLSATMLT
CKTPPHAVPSKQPVRLTVDSVARDAPVLYTYHQDPIISSIQPSRSFVSGGCTVAAHGLFL
QSGLQPQMVLTTGQDAEVFHVSCVYGENRTSIQCTTPSLAKLALQPPVVTKVAFVLDGYM
TEQWDLIYVEDPLFQDPKLTSKDNKSIVELKGDRMDREAMKCQVLTVSNHSCESLTLVGN
TLECTVPTELQTTTSKELQVEWRQADSIRHLGKVTLAQEQDYTGLIVGCMCVSLLLLLLG
TLLLWKKNKHIDDLSEVWYDGRGHIQHLDRLANARSVSPTNEMVSHESVDYRTNLLEDQG
SDRPETCRAGPPIYGGNGELLSPRLVALGSGLGLGMEGELVSPLLMAPVHIDPSCLHPDL
LTEVQHVVIAREQLLLHLNQVIGRGHFGCVFHGTLLEPDGQKQHCAVKSLNRITDLEEVS
QFLKEGIIMKDFSHPNVLSLLGICLPPEGSPLMVLPYMKHGDLRNFIRDESHNPTVKDLM
GFGLQVARGMEYLASKKFVHRDLAARNCMLDESYTVKVADFGLARDVYDKEYYSVHNKSG
VKLPVKWMALESLQTHKFTSKSDVWSFGVLLWELMTRGAPPYSDVNSFDITVFLLQGRRL
LQPEFCPDALYTVMIECWHPNPERRPSFSELVEPISSIFSSFSGEHYILLNTTYVNIEKL
NPYPSLFASTHLTPSSSSLSSDPTTSTSLPAQSPLFCRVERACCT
Download sequence
Identical sequences H2V3S7
XP_011605625.1.43653 ENSTRUP00000043861 ENSTRUP00000043861 31033.ENSTRUP00000043861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]