SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011610602.1.43653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011610602.1.43653
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.28e-47
Family Calponin-homology domain, CH-domain 0.000000621
Further Details:      
 
Domain Number 2 Region: 185-244
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.62e-19
Family EB1 dimerisation domain-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011610602.1.43653
Sequence length 260
Comment PREDICTED: microtubule-associated protein RP/EB family member 3-like [Takifugu rubripes]; AA=GCF_000180615.1; RF=representative genome; TAX=31033; STAX=31033; NAME=Takifugu rubripes; AL=Chromosome; RT=Major
Sequence
MALNVFSTSMTTENLSRHDMLAWVNDTLQLTYTKIEQMCSGTAYCQFMDMLFPGCIMMKK
VKFNAKLEHEYIYNFKILQLSFKKMDVDKIVPVERLVKGKFQDNFEFLQWFKKFFDANWD
GKDYDPVLTRQGPETTLPPSHPGSLRSSPSPTAVKPVPTPPRQNSAAAPRRTTSVTRNGV
DAEVLVLSQQLSELKLGVEGLEKERDFYFRKLRDIEVICQEHENDHPGISRIIEVLYATE
DGFAPPEDSEDEEQGDHWES
Download sequence
Identical sequences H2SLF5
ENSTRUP00000013241 31033.ENSTRUP00000013241 ENSTRUP00000013241 XP_011610602.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]