SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011634652.1.19355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011634652.1.19355
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.45e-31
Family Cap-Gly domain 0.00085
Further Details:      
 
Domain Number 2 Region: 129-373
Classification Level Classification E-value
Superfamily L domain-like 8.16e-23
Family Internalin LRR domain 0.025
Further Details:      
 
Domain Number 3 Region: 441-524
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000382
Family Ubiquitin-related 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011634652.1.19355
Sequence length 524
Comment PREDICTED: tubulin-specific chaperone E [Pogonomyrmex barbatus]; AA=GCF_000187915.1; RF=representative genome; TAX=144034; STAX=144034; NAME=Pogonomyrmex barbatus; AL=Scaffold; RT=Major
Sequence
MVEDKKYEIGSRIECDGYRGTLKYVGSVGDTKGEWLGIDWDDPTRGKHNGTYEGMEYFQA
RHSTSGSFIRPGKAKFGISCPQAIEMRYGLIDDELAGIDRGEVSSLRKEINAPFLELVGF
SEVNKKQSKFDELKIAWLRDQRVSNAGKPGELEELCPNLEDLDLSKNLINSWKIIAEICS
QLCSLVFLNVSENYLPIEDVATLEDSFPTVRLLTIAKMNYNWSDIRQCISIFPSIEELSV
SFNVISTIDEITVNTDLMKISTLILEGNLISSWDEILKLGSLPCLENLNVSSNKIDRIVF
PSSASTHKTALFPKLYQLNISENNISEWQSISELDKLSKLDDLKFRENPVLKNKSIETAR
QLIIAKIENLMHLNGTLIFHDERRGAEYDYLKLYLPIWLETENNPEKRMTFINEHPRYPI
LVDKYGIADIPSIRPKVEFISNVITVDFVCPDDPSHKIKRKLFKDMDVQKMIGVAQRLFK
TDGKIPTLSFIPRNHSSDEIPLDKPLQKVSYYSIQDGDQIIVRW
Download sequence
Identical sequences PB10800-RA XP_011634652.1.19355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]