SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011636282.1.19355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011636282.1.19355
Domain Number 1 Region: 583-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.59e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000114
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 323-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000004
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 512-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000355
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 632-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000015
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 473-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000726
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 7 Region: 406-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000858
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011636282.1.19355
Sequence length 1146
Comment PREDICTED: uncharacterized protein LOC105426662 isoform X1 [Pogonomyrmex barbatus]; AA=GCF_000187915.1; RF=representative genome; TAX=144034; STAX=144034; NAME=Pogonomyrmex barbatus; AL=Scaffold; RT=Major
Sequence
MDVTGDLNLQWVGDVELHEEVICGLEAQLVASEEEVIGACEEVAVEETVESIPDVVPTTE
SEILMVPQSNDMESIYIVPQDQGHDYLNIQVTEEVIADNWDRPGTDDGVEIPETKVTHDN
LLEYDDMEIPLPIDQDSYQNARPYPCDFCSRRFRKKANLMNHIVAHQTDRPYGCNLCGVR
YMRKCDLNNHLKVHAYAPPSQDGLEDDLNDEDSLMAEEEDVSTTGNKGRRKKVQSSAPRK
RKSNAAANVSKRNTEDIKIEMGKYVYKPYDDYKDTLLLYEDELTNNYSAHSGNYASSSRW
QMEEISVTGRQQTQQWPITDPTKPYVCQTCGIGFAREKALASHARIHGGDSPFECTSCSE
MFWDVNSLREHVRVKHGGTIPQQTSDAEEYDNDATYTGDSERVGEFYCNTCAVPFHRLDL
LKRHQKIHIKPEMDTMESSSQHHMCNVCGEEFEEALALLAHAELHASRSPSRCCLLCGAR
CRDEAEVADHLRQNHQDAPPNTCTMCGKTCKDKRSLVKHLWIHNVDKTFVCTKCGKRFHS
KARLRRHMVSHRNKMVACDECGEEFPDGRALVSHRHSHNRELGGRSFPCRECGKTFGSRS
SQQIHIRIHTGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLRE
HVRAHHSGPDPKCVGSATPYLCKVCGMSCGTSEEIVAHIVQHCDDNTALKRQPQSGPRKY
KRRRKTKPLETNTVVRRNEFGFDIMENSGGITGGAIVSNTSGIGGSSGVGGGGTATGGSD
SEDNTKRKLGKKNKQRSNVEEGYQNVLKSFESSLQNINSIVSNSKLNASKSKLSKKKLRK
EEKKQEAQASNQSGRPKMIHTQKTRVPVEVGSDGAKKGQKTKTMVTRTPKVMPNEHKSGI
FPGGERNRPRTKNVSYHIEGKSQLTPAMFPTKSTKEDTMSAQQQLLTNIKQEPSMPKTAD
SHRNNNGNILALGKSQESSKKKSTTNLKRTRRQRHTIVKQELNTSIMPDVQEQQQEQLQL
RNNNNNNNTMEDSNDQVRLMEHAVDGSNLEVAFEASVITAQDEDEEESILPHDAIQEMSN
GDNNVKLSVKVESAPQSRMLAVHSVIAPVDDVPETIIPDRIEYTCEMCAAVFSSRAELLV
HVPIHI
Download sequence
Identical sequences XP_011636282.1.19355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]