SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011636283.1.19355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011636283.1.19355
Domain Number 1 Region: 555-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000114
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 295-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000392
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 484-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000347
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 604-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000145
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 445-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000707
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 7 Region: 378-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000858
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011636283.1.19355
Sequence length 1118
Comment PREDICTED: RE1-silencing transcription factor isoform X2 [Pogonomyrmex barbatus]; AA=GCF_000187915.1; RF=representative genome; TAX=144034; STAX=144034; NAME=Pogonomyrmex barbatus; AL=Scaffold; RT=Major
Sequence
MDVTGDLNLQWVGDVELHEEVICGLEAQLVASEEEVIGACEEVAVEETVESIPDVVPTTE
SEILMVPQSNDMESIYIVPQDQGHDYLNIQVTEEVIADNWDRPGTDDGVEIPETKVTHDN
LLEYDDMEIPLPIDQDSYQNARPYPCDFCSRRFRKKANLMNHIVAHQTDRPYGCNLCGVR
YMRKCDLNNHLKVHAYAPPSQDGLEDDLNDEDSLMAEEEDVSTTGNKGRRKKVQSSAPRK
RKSNAAANVSKRNTEDIKIEMGNGNYASSSRWQMEEISVTGRQQTQQWPITDPTKPYVCQ
TCGIGFAREKALASHARIHGGDSPFECTSCSEMFWDVNSLREHVRVKHGGTIPQQTSDAE
EYDNDATYTGDSERVGEFYCNTCAVPFHRLDLLKRHQKIHIKPEMDTMESSSQHHMCNVC
GEEFEEALALLAHAELHASRSPSRCCLLCGARCRDEAEVADHLRQNHQDAPPNTCTMCGK
TCKDKRSLVKHLWIHNVDKTFVCTKCGKRFHSKARLRRHMVSHRNKMVACDECGEEFPDG
RALVSHRHSHNRELGGRSFPCRECGKTFGSRSSQQIHIRIHTGERPYGCRFCWKAFADGG
TLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPDPKCVGSATPYLCKVCGMS
CGTSEEIVAHIVQHCDDNTALKRQPQSGPRKYKRRRKTKPLETNTVVRRNEFGFDIMENS
GGITGGAIVSNTSGIGGSSGVGGGGTATGGSDSEDNTKRKLGKKNKQRSNVEEGYQNVLK
SFESSLQNINSIVSNSKLNASKSKLSKKKLRKEEKKQEAQASNQSGRPKMIHTQKTRVPV
EVGSDGAKKGQKTKTMVTRTPKVMPNEHKSGIFPGGERNRPRTKNVSYHIEGKSQLTPAM
FPTKSTKEDTMSAQQQLLTNIKQEPSMPKTADSHRNNNGNILALGKSQESSKKKSTTNLK
RTRRQRHTIVKQELNTSIMPDVQEQQQEQLQLRNNNNNNNTMEDSNDQVRLMEHAVDGSN
LEVAFEASVITAQDEDEEESILPHDAIQEMSNGDNNVKLSVKVESAPQSRMLAVHSVIAP
VDDVPETIIPDRIEYTCEMCAAVFSSRAELLVHVPIHI
Download sequence
Identical sequences XP_011636283.1.19355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]