SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011645236.1.19355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011645236.1.19355
Domain Number 1 Region: 155-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000099
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 2 Region: 119-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 70-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000581
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 35-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000183
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011645236.1.19355
Sequence length 214
Comment PREDICTED: neurogenic locus Notch protein-like [Pogonomyrmex barbatus]; AA=GCF_000187915.1; RF=representative genome; TAX=144034; STAX=144034; NAME=Pogonomyrmex barbatus; AL=Scaffold; RT=Major
Sequence
MSLPRRRLDYALTVGPLLLVLLAFTYVPAVSGFVSCSPSPCKNGGHCVSSPRGESHCNCT
SKYVGEYCQHLNPCYTGSRCQNGGSCRVREGIGGGTPSFTCACPVGFTASLCEIPIENAC
DSSPCLNGATCNLKSLHEYVCTCSIGYTGEHCERQDYCASSPCRNRAECRSLEDSYMCTC
APGFTGLNCADDIDECERNPCKHGTCKNIHGSYR
Download sequence
Identical sequences XP_011645236.1.19355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]