SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011661123.1.5271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011661123.1.5271
Domain Number 1 Region: 247-306
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000229
Family PB1 domain 0.00054
Further Details:      
 
Domain Number 3 Region: 1063-1098
Classification Level Classification E-value
Superfamily UBA-like 0.0000000481
Family UBA domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011661123.1.5271
Sequence length 1109
Comment PREDICTED: next to BRCA1 gene 1 protein isoform X2 [Strongylocentrotus purpuratus]; AA=GCF_000002235.4; RF=representative genome; TAX=7668; STAX=7668; NAME=Strongylocentrotus purpuratus; AL=Scaffold; RT=Major
Sequence
MEENIALEVRFEGETQIYSPAYKTKWQDLLAMLKCSFDLEDIVVTYIDDEEDEIAVDTEE
EYDQAKALASKCNNVLRLRVSRVIILDTLPKESPSLPETTEAVKRKRMHTPPRPEKETPY
PQPGPALPSTPPIPVPPPRPKVPPRLNRTTSLPGHKQPTDVSGYVMKAMEELKQLNISTP
EQSDGPNKEKEVIDQIVKGVLDGLGSGPLEKTRPFSWEPSQMLAGTRTPMCSSPLTAEQG
TKPKNRTPAKLVHEGITCDKCEGVITGFRYKCGHCLDFDLCEECEAQPGSHDPNHVFLKL
KRPAYRVGVKSDGRVAPIFKHPIYADDDTPVWEYKIKKLEEKMARKAARAELKRKYREEK
HRVRVECHSQVSPTKRERIEKMAEKQAEQIMAAASIAATPTTPTTSAADSTTEITPLLAL
LDNVEDSESIIIIKYGAGFVSDGNLPDETHLQPLTKFVKSWIMINNGSVKWNSDTKLKYL
WGNIKILSADSMDIPLLSPGEEGPICVDFEASDKPGHYQSHWRLTQKGEQFGHRVWCNII
VDKAEVLEPRCESKKTVQEELILPKVKEDETVETDSSENTPSSDMAHLQSDQSDSCSPTR
MASRSDVLTAHDVFSFELLSIHDDQEADKEVAGVNSPAATTTPNNTPIVGLTPCISPIPQ
LDEKLLCRRVSEHSDLEIIRREDIPEIIETQDMVRDEPGFEMAQDGVAVAFSFSDEDLDD
VESICSSSDSDMLDDYCVVPLPDCFDPTKPLDKSMILSRTSMSSSMTSSVLAPNAENAPL
VRLPSYEESQAELGGSTTPQASALIIQEDEVPQFSAAAEDITAPSAEQDGGRTEEIIQME
EVPEEEATNVAPSVDAILSTSNPALEITPLIPLVAATPVQTTIPPSSPKPTTPSQETVTM
APMPEITLLASPVPTQFEEAVLINPEGSVMYATRQPEVVRETRTTPVSSAAEGTNLDLIE
TTVQPQETQVQDRERHEEHDDEFHDAQDVPTQQENTQYNNTYNDVQVEADPVDLLGYTAA
RAVEVAGNVVRQAFGTAASSVNALLRPQPIPRPAPYEPPNLSSMDQLIEMGFGDRTKNQQ
LLEKHNDDVSKCVQDLLQAEDNDWTDNRH
Download sequence
Identical sequences W4ZC17
SPU_025701 7668.XP_001186499 XP_011661123.1.5271 XP_791508.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]