SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011671630.1.5271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011671630.1.5271
Domain Number 1 Region: 35-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000479
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 2 Region: 74-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000697
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 3 Region: 1-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000367
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 4 Region: 112-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000586
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011671630.1.5271
Sequence length 163
Comment PREDICTED: fibropellin-3-like, partial [Strongylocentrotus purpuratus]; AA=GCF_000002235.4; RF=representative genome; TAX=7668; STAX=7668; NAME=Strongylocentrotus purpuratus; AL=Scaffold; RT=Major
Sequence
DCTPDPCQNGGTCTDGVNDYTCACVLGYTGNDCETDIDDCNPDPCENGGTCTDGVNDYTC
ACVMGYAGKDCETNIDDCNPDPCENGGTCTDGVNDYTCACVMGYAGKDCETNIDDCNPDP
CDNRGTCTDRVNDYTCACEMGYAGKDCETNIDDCNPDPCENGG
Download sequence
Identical sequences XP_011671630.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]