SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011676253.1.5271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011676253.1.5271
Domain Number 1 Region: 101-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000167
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 27-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000911
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 139-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 4 Region: 62-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011676253.1.5271
Sequence length 189
Comment PREDICTED: fibropellin-3 [Strongylocentrotus purpuratus]; AA=GCF_000002235.4; RF=representative genome; TAX=7668; STAX=7668; NAME=Strongylocentrotus purpuratus; AL=Scaffold; RT=Major
Sequence
MGPILNLVTTIAVIVLGVQTVRVSGAGECASDSCQHGGTCTEGVNAFTCACVPGYNGDMC
QTDIDDCATSPCEDDETCTDGVNSYRCASCNAGFTGPGCSTDIDECHSTPCMHEGTCIDN
VNSFTCACVDGYTGTVCGTDIDECVVDTTLCANGMCSNTPGSYSCSPCDSGYELNDDSTA
CNGKDVKSI
Download sequence
Identical sequences XP_011676253.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]