SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011696799.1.89273 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011696799.1.89273
Domain Number 1 Region: 581-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.68e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 622-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000117
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000185
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 324-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000203
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 5 Region: 498-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000903
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 6 Region: 551-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000999
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 7 Region: 406-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000818
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011696799.1.89273
Sequence length 1152
Comment PREDICTED: uncharacterized protein LOC105455280 isoform X2 [Wasmannia auropunctata]; AA=GCF_000956235.1; RF=representative genome; TAX=64793; STAX=64793; NAME=Wasmannia auropunctata; AL=Scaffold; RT=Major
Sequence
MDVAGDLNLQWVGDVELHEEVICGLEAQLVASEEEVIGACEEVAVEETVESVPVAPATES
EILMVPQSNDMESIYIVPQDQGHDYLNIQVTEEVIADNWDRPGPDDGVEIPEAKVTHDNL
LEYDDMEIPLPIDQDSYQNARPYPCDFCSRRFRKKANLMNHMVAHQIDRPYGCNLCGSRY
VRKCDLNNHLKVHAYAPSSQDGLEDDLNDEDSLVAEEEDVATSGNKGRRKKVQSSAPRKR
KNNTAAGVPKRKTEELKMEMGKYVYEPDIDYTDTLLAYVDETLTDDCFARSGNFASSSRW
QVEQMSSATGRQQPQQWPITDPTKPYVCQSCGIGFAREKALASHARVHGGDSPFECTSCS
ELFWDANSLREHVRMKHGGTVTQISDAEEYDNDATYAGDNERLGEFYCKVCAVPFQRLDL
LKRHQKIHNVKPDMDTMESSQHHMCNVCGEQFEEALALLAHAELHASSRRCLLCGARCRD
EAEVAEHVRQNHAEDAPPNTCTLCGKTCKDKRSLLKHSWIHNVDKTFGCTKCSKRFHSKA
RLRRHMVSHRNKMVACDECGEEFPDGRALVSHRHSHNRELGGRSFPCRECGKTFGSRSSQ
QIHIRIHTGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHV
RAHHSGPDPKCVGSATPYLCKVCGESYGTSEEIVAHIVQHCDDNTALRRQPQTGPRKYKR
RRKTKPLETNAAAARRNEFTYDMMEGSGGGGVTGVTGASTGSGTVGGSGTVGGGAGTGGS
DSEDNTKRKLGKKNKQHRSNVVEEGYQNVLKSFESSLQNINSIVSNSKLNASKSKVSKKK
LRKEEKKQEAQASNQSGRPKMIHTQKTRVPVEMGSDGAKKGQKTKTMVTRTPKVMPNEHK
AGIFPGGERNRPRTKNVSYHVEGKSQIAPATFPAKSAKEDASTVSQQQLLLANVKQEPSV
QKTAGDSHRNNNGNILALNKTQPSNKRKSSATTKRTKKQKQTVMKREMNTSIEIAAEEQQ
QQQQQQLQLRNNNNNTMENSDDPVQLIHHAVDGNNLEVAFEASVVTAQDDEVESILPHNA
DQDMGNGDNNVKLSVKVESTPQTRMLAVHSVIAPVDNVPETIIPDTVEYTCEMCDMQFSS
RAELLVHVPVHI
Download sequence
Identical sequences XP_011696799.1.89273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]